SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000014927 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000014927
Domain Number 1 Region: 272-517
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 4.06e-62
Family Nuclear receptor ligand-binding domain 0.00000000244
Further Details:      
 
Domain Number 2 Region: 166-242
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.12e-25
Family Nuclear receptor 0.0000216
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000014927   Gene: ENSLAFG00000017799   Transcript: ENSLAFT00000017799
Sequence length 547
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_9:39793440:39844187:-1 gene:ENSLAFG00000017799 transcript:ENSLAFT00000017799 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSFRASSHKEFSQLLPVQDMDIKNSPSSLNSPVSYNCSQSVLPLEHGPIYIPSSYVESHH
EYSAMTFYSPTVMNYSIPSSANNSEGGPGRQATSPNVLWPTPGHLSPLAIHCQSSLLYAE
PQKSPWCEARSLEHALPINRETLKRKVSGSSCTSPVTSPSSKRDAHFCAVCSDYASGYHY
GVWSCEGCKAFFKRSIQGHNDYICPATNQCTIDKNRRKSCQACRLRKCYEVGMVKCGSRR
EKCGYRVVRRQRNPKEQLHCLSKAKKNDGNATRGKELLLNALSPEQLVLTLIEAEPPNVL
VSRPTSPFTEASMMMSLTKLADKELVHMIGWAKKIPGFVELSLYDQVRLLESCWMEVLMV
GLMWRSIDHPGKLIFAPDLILDRDEGKCVEGILEIFDMLLATTSRFRELKLQHKEYLCVK
AMILLNSSMYPLAAATQEAESSRKLTHLLNAVTDALVWVIAKSGISSQQQSVRLANLLML
LSHVRHASNKGMEHLLSMKCKNVVPVYDLLLEMLNAHSLRGYKPSGSECSPAEESKNKGS
CQAPQSQ
Download sequence
Identical sequences G3TJL2
XP_003408751.2.64505 ENSLAFP00000014927

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]