SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000015125 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000015125
Domain Number 1 Region: 142-357
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 4.84e-55
Family DBL homology domain (DH-domain) 0.00037
Further Details:      
 
Domain Number 2 Region: 340-473
Classification Level Classification E-value
Superfamily PH domain-like 5.91e-32
Family Pleckstrin-homology domain (PH domain) 0.0025
Further Details:      
 
Domain Number 3 Region: 451-491,530-588
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 6.24e-20
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0028
Further Details:      
 
Domain Number 4 Region: 617-713
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000000015
Family Pleckstrin-homology domain (PH domain) 0.0000576
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000015125   Gene: ENSLAFG00000018041   Transcript: ENSLAFT00000018044
Sequence length 727
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_107:1785208:1877397:-1 gene:ENSLAFG00000018041 transcript:ENSLAFT00000018044 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESGAGSSIPSGAVAALGDLDAGPSSSSQEMPQELPICRDHAITSPGMLAAAGNGDSLLD
TGPTGEQSGKVPNRDSGIDSPSCSVTGESFTCEESSEARQGPTMLGLHPETDSQNASQDT
TSDVDEGSSEAGQGPAILRLHPEADFSVTQSTKPQQLFNIARELLHTEEAYVKRLHLLDQ
VFCTRLTEAGIPVEVTTGIFSNISSIYRFHGQFLLPELQARIAEEWDVNPRLGDILQKLA
PFLKMYGEYVKNFDRAMELVGTWTQRSVLFKDIVHDIQKQEVCGNLTLQHHMLEPVQRIP
RYELLLKDYLKRLPADAPDWRDAEKSLELISTAANHSNAAIRKMEKMHKLLEVYEQLGGE
EDIVNPANELIKEGHIQKLSAKNGTTQDRYLFLFNSMVLYCVPKLRLMGQKFSVREKMDI
SDLQVQDIVKQNAAHTFVITGRKRSLELQTRTEEEKNEWIQVIRTTIEKHKQNSETFKAF
SGPLSWNEDSTLPPEPSVMGASSVEPMVATDGSRGAGRLDSRKSSSKTRREKERQSCKSC
GETFNSITKRRHHCKQCSAVICGKCSEFKTENSRQSRVCKECFLNLSADPASPSSEAPTE
PKKGTEKPPAADPQDSLLCGTLQLSEDGKAWSEVCASIPRTDPQVLHLQGGSQDGQPPRI
VPLPGCKVNAPDPAEMPDGRHMLKLHHKHLCLYLDTQAAELQQQWLDALSAAAHGDPALP
SLGTPQP
Download sequence
Identical sequences G3TK13
ENSLAFP00000015125 ENSLAFP00000015125

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]