SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000015420 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000015420
Domain Number 1 Region: 548-673
Classification Level Classification E-value
Superfamily PH domain-like 5.57e-20
Family Pleckstrin-homology domain (PH domain) 0.026
Further Details:      
 
Domain Number 2 Region: 85-262
Classification Level Classification E-value
Superfamily ARM repeat 0.0000000202
Family HspBP1 domain 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000015420   Gene: ENSLAFG00000018399   Transcript: ENSLAFT00000018401
Sequence length 727
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_5:20577829:21080641:1 gene:ENSLAFG00000018399 transcript:ENSLAFT00000018401 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPPPVDIVKVAIECPDAYPKLMEIDQKKPLSAIIKEVCDGWSLANHEYFALQYAEGSNFY
ITEKNRNEIKNGAILRLTTSPAQNAQQLHERIQSSSMDAKLEALKDLASLSRDVTFAQEF
INLDGISLLTQMVESGTERYQKLQKIMKPCFGDMLSFTLTAFVELMDHGIVSWDTFSVAF
IKKIASFVNKSAIDISILQRSLAILESMVLNSHDLYQKVAQEITIGQLIPHLQGTDQEIQ
TYTIAVINALFLKAPDERRQEMANILAQKQLRSIILTHVIRAQRAINNEMAHQLYVLQVL
TFNLLEDRMMTKMDPQDQAQRDIIFELRRIAFDAESEPNNNSGSMEKRKSMYTRDYKKLG
FINHVNPAMDFTQTPPGMLALDNMLYFAKHHQDAYIRIVLENSSREDKHECPFGRSSIEL
TKMLCEILKVGELPSETCNDFHPMFFTHDRSFEEFFCICIQLLNKTWKEMRATSEDFNKV
MQVVKEQVMRALTTKPSSLDQFKSKLQNLSYTEILKIRQSERMNQEDFQSRPILELKEKI
QPEILELIKQQRLNRLVEGTCFRKLNSRRRQDKFWYCRLSPNHKVLHYGDLEESPQGEVP
HDSLQDKLPVADIKAVVTGKDCPHMKEKGALKQNKEVLELAFSILYDSNCQLNFIAPDKH
EYCIWTDGLNALLGKDMMSDLTRNDLDTLLSMEIKLRLLDLENIQIPDAPPPIPKEPSNY
DFVYDCN
Download sequence
Identical sequences G3TKQ5
ENSLAFP00000015420 XP_003406984.1.64505 ENSLAFP00000015420

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]