SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000015514 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000015514
Domain Number 1 Region: 23-139,329-637
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 5.62e-72
Family Integrin alpha N-terminal domain 0.000038
Further Details:      
 
Domain Number 2 Region: 159-353
Classification Level Classification E-value
Superfamily vWA-like 1.24e-51
Family Integrin A (or I) domain 0.000000798
Further Details:      
 
Domain Number 3 Region: 637-783
Classification Level Classification E-value
Superfamily Integrin domains 5.75e-29
Family Integrin domains 0.0041
Further Details:      
 
Domain Number 4 Region: 784-797,826-947
Classification Level Classification E-value
Superfamily Integrin domains 2.82e-21
Family Integrin domains 0.0044
Further Details:      
 
Domain Number 5 Region: 965-1145
Classification Level Classification E-value
Superfamily Integrin domains 0.000000000000183
Family Integrin domains 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000015514   Gene: ENSLAFG00000018505   Transcript: ENSLAFT00000018509
Sequence length 1188
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_59:14066112:14225462:-1 gene:ENSLAFG00000018505 transcript:ENSLAFT00000018509 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDLPRGLVVAWALSLWPGFTDTFNMDTRRPRVISGPSTAFFGYTVQQHEISGKKWLVVGA
PLETNGHQKTGDVYKCPVIHGNCTKLNLGRVTLSNVSERKDNMRLGLSLATNPKDNSFLA
CSPLWSHECGSSYYTTGMCSRVNSNFRFSKTVAPALQRCQTYMDIVIVLDGSNSIYPWVE
VQHFLINILKKFYIGPGQIQVGVVQYGEDVVHEFHLNDYRSVKDVVEAASHIEQRGGTET
RTALGIEFARSEAFQKGGRKGAKKVMIVITDGESHDSPDLKKVIQQSERDNVTRYAVAVL
GYYNRRGINPETFLNEIKYIASDPDEKHFFNVTDEAALKDIVDALGDRIFSLEGTNKNET
SFGLEMSQTGFSSHVVEDGILLGAVGAYDWNGAVLKETSGGKVIPHRESYLKEFPEELKN
HGAYLGYTVTSVVSSRQGRVYVAGAPRFNHTGKVILFTMHNNQTLTIHQALRGEQIGSYY
GSEITSVDIDGDGVTDILLVGAPMYFSEGRERGKVYIYNLRQSQFVYNGTLKDSHSYQNA
RFGASIASVRDLNQDSYNDVVVGAPLEDNHGGVIYIFHGFQGSLLKKPKQRISASELAPG
LQYFGCSIHGQLDLNEDGLVDLAVGALGNAVILWSRPVLQINASLHFEPPKINIFHRDCK
RSGRDATCLVAFLCFTPVFLAPYFQMETVGLKYNATMDERRYTPRAHLDEGGDRYTHRSV
LLSSGQEHCERISFHVLDTADYVKPVTFSVEYALEAADHGPMLDDGWPTTLRVSVPFWNG
CNEDEHCVPDLVLDARSDLPTAMEYCQRVLRKPVQDCSAYTLSFDTTVFIIESTRRRVAV
EAMLENRGENAYSTALNISQSANLQFASLIQKDDFDGSIECVNEERRFHKKVCNVSYPFF
RAKAKVSFRLDFEFSKSVFLHHLEIQLAVGSDSDEQESTKEDNTALLRFHLKYEADILFT
RRTSLSHYEVKSNSSLERYDGMGPPFNSTFKIQNLGLFPIHGVMMKITVPIATRGGSRLL
MLKDVLTDQGNVSCNVWGNSTEYRRTPAEEDLSHAPQLNHSNSDVVSINCNVRLAPNQEI
NFHLLGNLWLTSLKALKYKSMKITVHAALQRQFHSPFIFREEDPSRQIVFEISKQEDMEI
PIWIILGSTLGGLLLLALLVLALWKLGFFKNAKRRREHSLDPDPKVLE
Download sequence
Identical sequences G3TKY6
XP_010596366.1.64505 ENSLAFP00000015514 ENSLAFP00000015514

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]