SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000015748 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000015748
Domain Number 1 Region: 80-156
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.02e-19
Family Ubiquitin-related 0.00016
Further Details:      
 
Domain Number 2 Region: 4-76
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000000000299
Family Ubiquitin-related 0.00053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000015748   Gene: ENSLAFG00000015773   Transcript: ENSLAFT00000015769
Sequence length 156
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_26:22445357:22445827:-1 gene:ENSLAFG00000015773 transcript:ENSLAFT00000015769 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQGFNLKVKMLSGQEILVPVTASMLLSELKQRVSKEIGVPTFQLRLAHSNGTVLQDGVPL
MDQSLGPGSMVLLIVDSCEPLSILVRNDKGRSVAYEVRLTDTVAQLKQQVCQQERVQADL
FWLTFEGRSLDEQKLLGDYGLTPRCTVYMNLRLRGG
Download sequence
Identical sequences G3TLH5
ENSLAFP00000015748 ENSLAFP00000015748

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]