SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000016090 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000016090
Domain Number 1 Region: 222-336
Classification Level Classification E-value
Superfamily Acid proteases 1.91e-27
Family Retroviral protease (retropepsin) 0.018
Further Details:      
 
Domain Number 2 Region: 4-88
Classification Level Classification E-value
Superfamily Ubiquitin-like 5.65e-17
Family Ubiquitin-related 0.0000566
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000016090   Gene: ENSLAFG00000020709   Transcript: ENSLAFT00000020861
Sequence length 399
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_26:6571402:6601296:-1 gene:ENSLAFG00000020709 transcript:ENSLAFT00000020861 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLTVYCVRRDLSEVTFSLQVDADFELHNFRALCELESGIPAAESQIVYAERPLTDNHRS
LASYGLKDGDVVILRQKESADPRPPVQFPNLPRIDFSSIAVPGTSSSRQRQPPGAQQPHS
SLGEIASSPQGLDNPALLRDMLLTNPHELSLLKERNPPLADALLSGDLEKFSRVLVEQQQ
DRARREQERIRLFSADPFDLEAQAKIEEDIRQQNIEENMTIAMEEAPESFGQVVMLYINC
KVNGHPVKAFVDSGAQMTIMSQACAERCNIMRLVDRRWAGIAKGVGTQKIIGRVHLAQVQ
IEGDFLACSFSILEEQPMDMLLGLDMLKRHQCSIDLKKNVLVIGTTGSQTTFLPEGELPE
CARLAYGAGREDLRPDETGDQELAEALQKSVEDAERQKP
Download sequence
Identical sequences G3TM23
ENSLAFP00000016090 XP_010591397.1.64505 ENSLAFP00000016090

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]