SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000016151 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000016151
Domain Number 1 Region: 1-159
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 4.71e-42
Family DBL homology domain (DH-domain) 0.00061
Further Details:      
 
Domain Number 2 Region: 151-281
Classification Level Classification E-value
Superfamily PH domain-like 2.58e-17
Family Pleckstrin-homology domain (PH domain) 0.045
Further Details:      
 
Domain Number 3 Region: 292-352
Classification Level Classification E-value
Superfamily SH3-domain 1.71e-16
Family SH3-domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000016151   Gene: ENSLAFG00000020832   Transcript: ENSLAFT00000020534
Sequence length 380
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_91:4886539:4912804:-1 gene:ENSLAFG00000020832 transcript:ENSLAFT00000020534 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LFSRLQDVRDVSTTFLSDLEENFENNIFTFHVCDVVLNHAPHFRRVYLPYVTNQTYQERT
FQSLLSSNSHFREVLERLESDPVCQRLSLKSFLILPFQRITRLKLLLQNILKRTQPGSSE
EAEATKAHHALEELIRDCNSNVQRMRRTEELIYLSQKIEFECRIFPLISQSRWLVKSGEL
TALEFSVSPGLRRKLNTRPIHLHLFNDCLLLSRPREGSRFMVFDHAPFSAVRGEKCEMKL
HGAHKNLFRLFLRHNTQGTQAEFLFRTETQSEKLRWISALTLPREEMDLLECYDSQQVRC
LRAYKPRENDELALEKADVVMVMQQSSDGWLEGVRLSDGERGWFPVQQVEFILNPDVCAR
NLQEAQRVKTARLQLVEHQA
Download sequence
Identical sequences G3TM61
ENSLAFP00000016151 ENSLAFP00000016151

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]