SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000016212 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000016212
Domain Number 1 Region: 134-231
Classification Level Classification E-value
Superfamily NSFL1 (p97 ATPase) cofactor p47, SEP domain 3.14e-32
Family NSFL1 (p97 ATPase) cofactor p47, SEP domain 0.0000132
Further Details:      
 
Domain Number 2 Region: 215-329
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.47e-24
Family UBX domain 0.0000692
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000016212   Gene: ENSLAFG00000020868   Transcript: ENSLAFT00000020651
Sequence length 332
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_77:1075271:1112280:-1 gene:ENSLAFG00000020868 transcript:ENSLAFT00000020651 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEGGGAEHGEQARQASVPRPPSARDLQLALAGLYEDEMKAKSSKTDRPKAMVFKSPRTP
SQRFCSSEHEYSGLHTVRPSTGQIVNELFREATEHGAVPLNEATRASGDDRSKSFTGGGY
RLGNSFCNRSEYIYGESQLQDVQILLKLWSNGFSLDDGELRPYSDPTNAQFLESVKRGEI
PLELQRLVHGSQVSLDMEDHQDQEYIKPRLRFKAFSGEGQKLGSLTPEIISTPSSPEEED
KSILNAVVLIDESVPTTKIQIRLADGSRLIQRFNITHSRILDVRDFIIQSRPEFAALDFI
LATSFPNKELTDGSLTLQEADVLNTVILQQLK
Download sequence
Identical sequences G3TM94
ENSLAFP00000016212 ENSLAFP00000016212

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]