SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000016307 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000016307
Domain Number 1 Region: 237-457
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.36e-54
Family DBL homology domain (DH-domain) 0.0000824
Further Details:      
 
Domain Number 2 Region: 448-585
Classification Level Classification E-value
Superfamily PH domain-like 2.39e-18
Family Pleckstrin-homology domain (PH domain) 0.024
Further Details:      
 
Domain Number 3 Region: 583-657
Classification Level Classification E-value
Superfamily SH3-domain 1.25e-16
Family SH3-domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000016307   Gene: ENSLAFG00000023223   Transcript: ENSLAFT00000022014
Sequence length 693
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_55:6250238:6329629:1 gene:ENSLAFG00000023223 transcript:ENSLAFT00000022014 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METKASEDPEKPWKKSVRHSWENDEPVKERPELPWKEETHHADQETPEPHRQIPIQRNSI
FNRAIRHRSKTKTRDNSEKNTGHHQAGSLENGKSANEPLALKVPQSRTPPWRIPTQTDPA
AQKTSESSSTPGNGTTPEECPALADSPTTLTEALQRIHPIPADSWRNLIEQIGLLYQEYR
DKSTLQEIETRRQQDAEIHDRSPASVEAPPASPPERKALPQICLLSNPHSRFNLWQDLPE
IRSSGVLEILQPEEVKLQEAMFELVTSEASYYKSLNLLVSHFVENERLKKVLHPAEAHLL
FSNVLDVTAVSERFLLELEHRMEENIVISDVCDIVYRYAANHFSVYITYVSNQTYQERTY
KQLLQEKAAFRELIAQLELDPKCKGLPFSSFLILPFQRITRLKLLVQNILKRVEEGSERE
CTAQDAHKELEMVVKACNEGVRKMSRTEQMVSIQRKMEFKIKSVPIISHSRWLLKQGELQ
QMSGPKTSRTLRTKKLFREIYLFLFNDLLVICRQIPGDKYQVFDSASRGLLRVEELEDQG
QTLANVFILRLLENADDREATYMLKASSQSEMKRWMTSLAPNRRTKFVSFTSRLLDCPQV
QCVHPYVAQQPDELTLELADILNILDKTEDGWIFGERLHDQERGWFPSSMTEEILNPKIR
SQNLKECFRVHKMEDPQRSQNKDRRKLGSRNRQ
Download sequence
Identical sequences G3TMG8
ENSLAFP00000016307 ENSLAFP00000016307

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]