SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000016484 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000016484
Domain Number 1 Region: 152-373
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 7.72e-50
Family DBL homology domain (DH-domain) 0.00028
Further Details:      
 
Domain Number 2 Region: 376-508
Classification Level Classification E-value
Superfamily PH domain-like 7.38e-21
Family Pleckstrin-homology domain (PH domain) 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000016484   Gene: ENSLAFG00000021440   Transcript: ENSLAFT00000022345
Sequence length 793
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_15:51160412:51176294:1 gene:ENSLAFG00000021440 transcript:ENSLAFT00000022345 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQTFGPPDEGPLQGLVASLIETYGGRHRASTQSTAGSLYPRGGAVPDPSRRLLQNYVPFV
KSSGQTRGLAPIWLREPEPEKRHGGHLGAGTPHSPKLKEVTKAHELKVRLHTFSMFGMPR
LPPEDRRHWEIGESSDSGLAIEKTWRELVPGHKEMSRELCHQQEALWELLTTEVIYVTKL
KIMTDLLAAGLLNLQRVGLLTEVSVETLFGNVPSLIRAHRGFWEEVLGPTLEETRASGQP
LDPVSLQNGFLTFGQRFHPYVQYCLRVKQTMAYAREQQENNPLFQIFVQWCEKHKRSGRQ
MLGDLLIKPHQRITKYPLLLQAVLKRSPEARAQEALNTMIASVESFLRYINRQVRQGEEQ
ESLVAVAQRIGPYEVLEPSSEEVEKNLRPFSTLDLTSPMLGVSPEHTRQLLLEGAVRVKE
GREAKLDVYLFLFTDVLLVTKPQRKADKAKVIRPPLMLEKLVFRPLRDPSSFLVINLTEF
QCVSSALIVYCPSSTDRAQWLEKTQKAQATLQKLKIEEYVQQKRDLLALYRDRDRDQESP
GTRPSTPSPEGSQGSAEGRAPEFSTIIPHLVVTEDTDEDAPSAPDDTSDSGYSTLIPGSP
KGPRSPLSRQRQRALRRDPRLTFSTLDLRNVPLRPQPPNSQAPQRRSAPDLPEEGIQRGS
SLPKGDPPTWSEEEDGTSGGGNAGVGTLHRARLRGQLSPSPIHVDSAGESPWDSSGDEDE
ESLFLEPSHVPSPRPLQAEDMLRQIREELASQRVEDAPEPPSARPRKLTRLQLQRMRGPH
IIQLDTPLSTSEV
Download sequence
Identical sequences G3TMV2
ENSLAFP00000016484 ENSLAFP00000016484

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]