SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000016515 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000016515
Domain Number 1 Region: 150-283,382-420
Classification Level Classification E-value
Superfamily Hemopexin-like domain 1.06e-44
Family Hemopexin-like domain 0.00066
Further Details:      
 
Domain Number 2 Region: 21-67
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.0000000000109
Family Somatomedin B domain 0.0000562
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000016515   Gene: ENSLAFG00000022478   Transcript: ENSLAFT00000022634
Sequence length 424
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_47:1263708:1266451:-1 gene:ENSLAFG00000022478 transcript:ENSLAFT00000022634 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPPRPLLMLALLAWAALADQESCKGRCTEGFNADKKCQCDELCSYYQSCCTDYIAECKP
QVTRGDVFTLPEDEYGTYDYRAEIKDNTSSHTQPESSAQGPDLLRSVEQSPVEILEKEDS
EPEKLIPGPEAETPGSGISDPGISESLEEEELCSGKPFDAFTDLKNGSLFAFRGQYCYEL
DEKAVRPGYPKLIRDVWGIEGPIDAAFTRINCQGKTYLFKGSQYWRYEDGVLDAGYPRNI
SGGFKGIPDNVDAALALPAHSYSGRERYFFKGYSGEWVGRMIRSVVQSPISLPHFRWGRP
PVIPKPQARGLPALLKGALLRPIAFVLRVYSSSRDLPVRREWERRPPGPLSLPPFSSEES
GLGYYDYDMDWLVPASCEPIQSVYFFSGDKYYRVNLRTKRVDTVSPPYPRPIAQYWLGCP
APGS
Download sequence
Identical sequences G3TMX5
ENSLAFP00000016515 ENSLAFP00000016515

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]