SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000016684 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000016684
Domain Number 1 Region: 156-367
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 7.59e-53
Family DBL homology domain (DH-domain) 0.0000783
Further Details:      
 
Domain Number 2 Region: 381-500
Classification Level Classification E-value
Superfamily PH domain-like 1.85e-20
Family Pleckstrin-homology domain (PH domain) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000016684   Gene: ENSLAFG00000022113   Transcript: ENSLAFT00000022813
Sequence length 596
Comment pep:novel supercontig:loxAfr3:scaffold_15:41562145:41631563:-1 gene:ENSLAFG00000022113 transcript:ENSLAFT00000022813 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPELATQKQPQLRRRSRRASGLSTSGATEPSANTPKPVSINRYSLRRGSSFTFLTPGPH
WDFSLKRKRREKDDDVVSLCSLDLKEPSNKRVRPLARVTSLANLISPVRNGAVRRFGQTI
QSFALRGDNRSPASAHKSYSRSTVPTPAKRRNSVLWSEMLDVSMKESLTTKEIKRQEAIY
EMSRGEQDLIEDLKLARKAYHDPMLKLSIMSEEELTHIFGDLDAYIPLHEDLLARIGEAT
KPDGTVEQIGHILVNWLPGLNAYKVYCSNQLAAKALLDQKKQDPRVQDFLQRCLESPFSR
KLDLWSFLDIPRSRLVKYPLLIKEVLRHTPKDHPDVQLLEEAVLIIQGVLSDINLKKGES
ECQYYIDKLEYLDEKQRDPRIEASKVLLCHGELKNKNGHKLYIFLFQDILVLTRPVTRNE
RHSYQVYRQPIPVQELVLEDLQDGDVRMGGSFRGAFSNSDKAKNIFRVRFQDPSPGQSHT
LQANDVFHKQQWFNCIRTAIAPFQQATSPTELKDLPELSEECEENNLSASNVKAQRRVST
VSSVVQVEVDENASEYGSSVQTAEDTKSVKVHRTQSGFRKARDKAQLSGKRKETLV
Download sequence
Identical sequences G3TN95
ENSLAFP00000018507 ENSLAFP00000016684

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]