SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000016741 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000016741
Domain Number 1 Region: 86-309
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.83e-57
Family DBL homology domain (DH-domain) 0.0002
Further Details:      
 
Domain Number 2 Region: 293-427
Classification Level Classification E-value
Superfamily PH domain-like 4.88e-31
Family Pleckstrin-homology domain (PH domain) 0.0069
Further Details:      
 
Domain Number 3 Region: 412-519
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 5.76e-23
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0021
Further Details:      
 
Domain Number 4 Region: 478-642
Classification Level Classification E-value
Superfamily PH domain-like 1.52e-19
Family Pleckstrin-homology domain (PH domain) 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000016741   Gene: ENSLAFG00000022338   Transcript: ENSLAFT00000021354
Sequence length 656
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_0:128235574:128259926:-1 gene:ENSLAFG00000022338 transcript:ENSLAFT00000021354 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEGADEKKLASVSNLVTVFENSRNPGAAPRAHMLEEDECYHSGCRPPQPPEPWEKPSLGE
SLESRPRTVSRRYLSSLKNKLSSGTWRKSYQPGTGPGSGTQEPEEKRIVQELLETEQAYV
ARLYLLDQVFFQELLKEARSSKAFSEDVVKLIFSNISSIYQFHSQFFLPELQRRLDDWTA
TPRIGDVIQKLAPFLKMYSEYVKNFERAADLLATWTDKSPPFQEVITRIQSSEASSSLTL
QHHMLEPVQRIPRYELLLKEYVQKLPAQAPDRDDAQKALDMIFSAAQHSNAAITEMERLQ
DLWEVYQRLGLEDDIVDPSNTLLREGPVLKISFRRNDPMERYLFLFNNMLLYCVPRVIQV
GAHFHVRTRIDVAGMKVRELSDVEFPHAFLVSGKQRTLELQARSQEEMISWLQACQAAID
QIEKRNETFKAAIQGPEGDTQEQELQSEELGLRAPQWVRDKMVTMCMRCQEPFNALTRRR
HHCRACGYVVCAKCSDYRAKLKYDDNRPNRVCCNCYTFLTGNLLPDDKEDKRRGILEKGS
AAGYEQNLMCSFLQLLGDRWGRNGPRGWCVIPWDDPFVLYIYAAPQDMRAHTSIPLLGYQ
VTAGSQADPRVFQLQQSGQLYTFKAETKELRGRWVKAVERAASGQSPGEPEGDLSD
Download sequence
Identical sequences G3TND4
ENSLAFP00000016741 XP_003403984.1.64505 ENSLAFP00000016741

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]