SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000017164 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000017164
Domain Number 1 Region: 735-981
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.84e-62
Family Nuclear receptor ligand-binding domain 0.0000000618
Further Details:      
 
Domain Number 2 Region: 595-677
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.36e-24
Family Nuclear receptor 0.0000243
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000017164   Gene: ENSLAFG00000022550   Transcript: ENSLAFT00000022551
Sequence length 983
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_51:8722547:9062374:1 gene:ENSLAFG00000022550 transcript:ENSLAFT00000022551 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METKGYHNHPEDLDMERRWGQISQAVEHSSLGPTERTDENKYMDIVNVSCVSGAIPNNST
QGSSKEKHELLPCLQQDNNRSGILTSDIKTELESKELSATVAESMGLYMDSIRDADYTYD
QQNQQGSMSPAKIYQNVEQLMKFYKENGHRPSMLNSVSRPLRSFMSDPMSCVNGGVMRAI
VKSPITCHEKSPSVCSPLNMASSGCSPSGINSVSSTTASFGSFAVHSPITGTPLTCSPNV
ENRGSRSHSPAHASNVGSPLSSPLSSMKSPISSPPSHCSVKSPVSSPNVTLRSSVSSPGN
INNSRCSVSSPSNTNNRSTLSSPTVGSICSPANSAFSYAASGTPVGSIATRDMIPSPDTH
EKGAPEVPFPKTEEIENAISNGVTGQLNIVQYIKPEPDGAFSSSCLGGNSKINSDSQFSV
PIKQESTKHSCSGTSFKGNPPVNPFPFMDGSYFSFMDDKDYYSLSGILGPPVPGFDGSCE
GGGFSMGIKQEPDDGSYYPETSMPSSAVVGVNSGGQSFHYRIGAQGTISLSRSARDQSFQ
HLSSFPPVSTLVESWKSHGDLPSRRSDGYPVLEYIPENVSSSTLRSVSTGSSRPSKICLV
CGDEASGCHYGVVTCGSCKVFFKRAVEGKCSWQHNYLCAGRNDCIIDKIRRKNCPACRLQ
KCLQAGMNLGARKSKKLGKLKGIHEEQPQQQQALPPPPPPQSPEEGTTYIAPMKEPSVNT
ALVPQLSTLSRALTPTPAMILENIEPEIVYAGYDSSKPDTAENLLSTLNRLAGKQMIQVV
KWAKVLPGFKNLPLEDQITLIQYSWMCLSSFALSWRSYKHTNSQYLYFAPDLVFNEEKMH
QSAMYELCQGMHQVSLQFVRLQLTFEEYTIMKVLLLLSTIPKDGLKSQAAFEEMRANYIK
ELRKMVTKCPNNSGQSWQRFYQLTKLLDSMHDLVSDLLEFCFYTFRESQALKVEFPAMLV
EIISDQLPKVESGNAKPLYFHRK
Download sequence
Identical sequences G3TP82
ENSLAFP00000024463 ENSLAFP00000017164

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]