SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000017281 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000017281
Domain Number 1 Region: 4-214
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.96e-44
Family DBL homology domain (DH-domain) 0.00038
Further Details:      
 
Domain Number 2 Region: 202-330
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000142
Family Pleckstrin-homology domain (PH domain) 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000017281   Gene: ENSLAFG00000022625   Transcript: ENSLAFT00000023126
Sequence length 331
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_6:64690696:64694054:1 gene:ENSLAFG00000022625 transcript:ENSLAFT00000023126 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESPDPSARCPLQEQRARWERKRACTARELLETERRYQEQLGLVATYFLGILRAKGTLRL
PERQVLFGPWELIYGASQDLLPHLEGGHWGQGLEGFCPHLQLYTQYAANADRSWTTLQEQ
LKKNKRFRRFVRLQEGRPEFGGLQLQDLLPLPLKRLQQYENLVVALAENTGPNSPDHQQL
TRAARLISETAQRVHAIGQRQKNDQHLQRVQALLSGRQAKGLITGRWFLHQGWLLVVPPH
GKPRPRMFFLFTDVLLMAKRRPPLHLLQSGTFACQALYPMAQCQLHRVFGHSGGPCGGLL
SLSFPHEKLLLMSTHQEELSRWYHSLTLAVR
Download sequence
Identical sequences G3TPG7
XP_010586152.1.64505 ENSLAFP00000017281 ENSLAFP00000017281

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]