SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000017398 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000017398
Domain Number 1 Region: 126-373
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 4.33e-69
Family Nuclear receptor ligand-binding domain 0.00000000432
Further Details:      
 
Domain Number 2 Region: 57-140
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.73e-30
Family Nuclear receptor 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000017398   Gene: ENSLAFG00000022279   Transcript: ENSLAFT00000022975
Sequence length 473
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_19:43690814:43717586:1 gene:ENSLAFG00000022279 transcript:ENSLAFT00000022975 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLSKTLVDMDMADYSAALDPAYTTLEFENVQVLTMGNDTSPSESANLNTPNSLGVSALC
AICGDRATGKHYGASSCDGCKGFFRRSVRKNHMYSCRFSRQCVVDKDKRNQCRYCRLKKC
FRAGMKKEAVQNERDRISTRRSSYEDSSLPSINALLQAEVLSQQITSPVSGINGDIRAKK
IASISDVCESMKEQLLVLVEWAKYIPAFCELPLDDQVALLRAHAGEHLLLGTTKRSMVFK
DVLLLGNDYIVPRHCPELAEMNRVSVRILDELVLPFQELQIDDNEYACLKAIIFFDPDAK
GLSDPSKIKRLRSQVQVSLEDYINDRQYDSRGRFGELLLLLPTLQSITWQMIEQIQFIKL
FGMKIDNLLQEMLLGGSSSDAPHAHHPLHPHLMQEHMGTNVIVANTMPAHLSNGQMCEWP
RPRGQAATPETPQPSPPGGSASEPYKLLPGAIATIVKPPSAIPQPTITKQEVI
Download sequence
Identical sequences G5E7C6
ENSLAFP00000017398 ENSLAFP00000017398

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]