SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000017530 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000017530
Domain Number 1 Region: 49-186
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.44e-37
Family Regulator of G-protein signaling, RGS 0.0001
Further Details:      
 
Domain Number 2 Region: 357-458
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.03e-32
Family Ras-binding domain, RBD 0.0000458
Further Details:      
 
Domain Number 3 Region: 301-370
Classification Level Classification E-value
Superfamily Ubiquitin-like 8.68e-20
Family Ras-binding domain, RBD 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000017530   Gene: ENSLAFG00000004553   Transcript: ENSLAFT00000021383
Sequence length 545
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_1:101996002:102010117:1 gene:ENSLAFG00000004553 transcript:ENSLAFT00000021383 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGKPKHLGVPNGRMVLAVSDGELSSVADSQDQGRGSSLSIHSLPSGPSSPFPTEEQSVA
GWALSFERLLQDPLGLAYFTEFLKKEFSAENVTFWKACERFQQIPASDTQQLAQEARNIY
EEFLSSQALSPVNIDRQAWLGEEVLAQPRPDMFRAPQLQIFNLMKFDSYARFVKSPIYRE
CLLAEAEGRPLREPGSSCLGSPDATRKKPKLKPGKSLPLGVEELGQLPPAEGPGGLPLRK
SFRRELASGAANLRRESQGSLNSSASLDLGFLAFVSSKSENQSHRKSLGSAEGESENRPG
KYCCVYLPDGTASLALARPGLTIRDMLASICEKRGLSLPDIKVYLVGKEQKALVLDQDCT
VLADQEVRLENRITFELELAALDRVVRISAKPTKRLQEALQPILAKHGLSPQQVTLHRPG
EKQPLDLEKLVSSVVAQRLVLDTLPGTKIPDAGNLSPRRSQGGPPRTQDKVAYSHPLPPN
SLAELPGSAAGKRQTCDIEGLVELLNRVQSSGAHDQRGLLRKEDLVLPEFLQLPTQGPSA
QEAPP
Download sequence
Identical sequences G3TPX3
ENSLAFP00000017530 ENSLAFP00000017530

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]