SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000017754 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000017754
Domain Number 1 Region: 193-382
Classification Level Classification E-value
Superfamily vWA-like 3.48e-43
Family Integrin A (or I) domain 0.0000377
Further Details:      
 
Domain Number 2 Region: 361-574,621-673
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 2.62e-31
Family Integrin alpha N-terminal domain 0.0014
Further Details:      
 
Domain Number 3 Region: 823-947
Classification Level Classification E-value
Superfamily Integrin domains 2.98e-28
Family Integrin domains 0.0036
Further Details:      
 
Domain Number 4 Region: 673-819
Classification Level Classification E-value
Superfamily Integrin domains 0.000000000732
Family Integrin domains 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000017754   Gene: ENSLAFG00000022680   Transcript: ENSLAFT00000022653
Sequence length 1174
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_47:7367686:7421362:-1 gene:ENSLAFG00000022680 transcript:ENSLAFT00000022653 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SKWLSQGLCASFVKCLSPLVGFNVDVAQTWVTPEGAPFVLSSLLHQDTSTNQTWCLFVVK
GRTTHNTGELQGCLAVSLPPYLALTISEHGLIPKGRHQGVTVVRNHHGVLICIQEKTRKS
HSLSPELTGTCSLLAPNFYPRAQAYFIDLENLLDPDVHVDAGDCYRNKKSSIEGNENSAR
WRRQVELEHMDLDPGTEIAIILDGSGSIDPPDFQKAKDFISNMMRTIYDKCFECSFALVQ
YGGVIQTEFDLRDSQDVMASLARVQNIIQVKNVTKTASAMQHVLDNIFTPSHGSRKKAAK
VMVVLTDGDVFQDPLNLTTVINSPKMQGVERFAIGVGDAFNKEQSDRELKLIASDPDETH
AFKVTNYTALGGLLSKLQQSIIHTEGASGDALHFQLAQTGFSAQILDEEQVLLGAVGAFD
WSGGALLYDTRSRRGRFLRQRMVDTKAAQYSYLGYSLAVLHRACGRSFVAGAPRHKQHGA
VFELQKEGTEAIFLPVLEGEQMGSYFGSELCPVDIDMDGTTDFLLVAAPFYHVHWEEGRV
YLYRLNQQVGASPSSRACRGHGSSAWHRTDGGWECWGPALAPEQNGQALGLELQGRRVGT
RADCDGLHKTKRISPFLTLSVSLLLQRISASAVGPGLHYFGMSLAGGFDFSGDGLADITV
GTLGRAVVLRSRPVVHLKVSVNFSPEALPIGFNGSVNVHLCFEISSGTPATETGLRETSL
NFTLDVDVMKQRKRLQCLDVKTCLSTFKEWSNGSRLCERFQLLPTEGELYEEDRFSNISV
KVSYQLQTPKTHRDHLYPILDLYTEPSAIFQLPYEKACKDKLFCEAKLQLTTTISQEELV
VGLTKELTMNMNVTNAGEDSYMTNLTLTYPRNLQFKRIQKPPSPNIQCDDPKPVASILVM
NCKIGHPIFKRSSADILVVWQLEEKAFPNRTADITVTITNSNERSSLPLPGKTTLRFKHA
FIAVLTKPSVMYMLTSQRLSDHKEFLFNIHGENLFEAKFQLQICVPIKIQGFQVVRVINL
TKTQAYTACAQSQERVCGSDPVQHVEEWHSVNCTITSDKENVTVAAELSFNQSAQLLRDV
TELQILGEISFNRSLYEGLNAENHRTKWTVYCLAESSVKSKPVSLSDILCGKNVLPKTLG
IYLHQCGFFKRKYQQLNLESMRRAQLKSEDLFTE
Download sequence
Identical sequences G3TQD9
ENSLAFP00000017754 ENSLAFP00000017754

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]