SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000017867 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000017867
Domain Number 1 Region: 177-459
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.1e-77
Family Nuclear receptor ligand-binding domain 0.00000000156
Further Details:      
 
Domain Number 2 Region: 127-204
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.47e-25
Family Nuclear receptor 0.0000114
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000017867   Gene: ENSLAFG00000007032   Transcript: ENSLAFT00000023074
Sequence length 460
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_74:4016002:4211570:-1 gene:ENSLAFG00000007032 transcript:ENSLAFT00000023074 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDCTDSSLKQWQSTHVQTYFRLLCRMSNKDRHIDSSCSSFIKTEPSSPASLTDSVNHHSP
GGSSDASGSYSSTMNGHQNGLDSPPLYPSAPILGGSGPVRKLYDDCSSTIVEDPQTKCEY
MLNSMPKRLCLVCGDIASGYHYGVASCEACKAFFKRTIQGNIEYSCPATNECEITKRRRK
SCQACRFMKCLKVGMLKEGVRLDRVRGGRQKYKRRIDAENSPYLNPQLVQPAKKPYNKIV
SHLLVAEPEKIYAMPDPTVPDSDIKALTTLCDLADRELVVIIGWAKHIPGFSTLSLADQM
SLLQSAWMEILILGVVYRSLSFEDELVYADDYIMDEDQSKLAGLLDLNNAILQLVKKYKS
MKLEKEEFVTLKAIALANSDSMHIEDVEAVQKLQDVLHEALQDYEAGQHMEDPRRAGKML
MTLPLLRQTSTKAVQHFYNIKLEGKVPMHKLFLEMLEAKV
Download sequence
Identical sequences G3TQM6
ENSLAFP00000017867 ENSLAFP00000017867

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]