SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000017870 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000017870
Domain Number 1 Region: 281-469,538-576
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 5.89e-36
Family Phospholipase D 0.07
Further Details:      
 
Domain Number 2 Region: 593-795
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 6.28e-29
Family Nuclease 0.039
Further Details:      
 
Domain Number 3 Region: 62-195
Classification Level Classification E-value
Superfamily PX domain 0.00000000000000196
Family PX domain 0.0081
Further Details:      
 
Domain Number 4 Region: 229-302
Classification Level Classification E-value
Superfamily PH domain-like 0.00000244
Family Pleckstrin-homology domain (PH domain) 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000017870   Gene: ENSLAFG00000022497   Transcript: ENSLAFT00000021668
Sequence length 934
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_47:10335866:10346272:-1 gene:ENSLAFG00000022497 transcript:ENSLAFT00000021668 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMATPESLFSTGGDLDPSQLQMEPDEVDTLREGEDPADRMHPFLAIYDLRPLKMHPLVFA
PGVPVTAQVVGTERYTSGSKVGTCTLYSVRLTHGDFTWTTKKKFRHFQELHRDLLRHKVL
MSLLPLARFAVAYAPAGEAANREIPSLPRAVPEGSARHAASKQKYLENYLNRLLAMSFYR
NYHAMTEFLEVSQLSFITDLGSKGLEGVIRKRSGGHRVPGLTCCVRDQVCYRWSKRWLVV
KDSFLLYMCLETGVISFVQLFDPGFEVQVGKRSTETRYGVRIDTSHRSLILKCSSYRQAR
WWGQETELAQGPGRDFLQLHQHDSYAPPRPGSLARWFVNGAGYFAAVADAILRAREEIFI
TDWWLSPEVYLKRPAHSDDWRLDVMLKRKAASGGGNVPILAQCWQTSLLLAPSSLVRTDT
LMLLHPNIKVMRHPDQVTLWAHHEKLLVVDQVVAFLGGLDLAYGRWDDSHYRLTDLGDSS
ESAAPQPPTPCPGSPATPDLSHNQHFWLGKDYSNLITKDWVQLDRPFEDFIDRETTPRMP
WRDVGVVVHGPPARDLARHFIQRWNFTKTTKAKYKIPMYSYLLPKSSNTANQLPFIFPGA
QCATVQVLRSVDRWSAGTSENSILNAYLHTIRESQHFLYIENQFFISCSDGRTVLNKVGD
EIVDRILKAHKQGQCFRVYVLLPLLPGFEGDISTGGGNSIQAILHFTYRTLCRGEYSILH
RLKAAMGTAWRDYMSICGLRTHGELGGHPVSELIYIHSKMLIADDRTVIIGSANINDRSL
LGKRDSELAVLVEDTEMEPSLMNGVYQAGRFALSLRKHCFQSMILGASAQPDLDLRDPVC
DDFFQLWQETAENNANIYEQIFRCLPSNATRSMRALRAYVAVEPLATVSPPLAQSELTKV
QGHLVHFPLRFLEDESLLPSLGSKEGMIPLEVWT
Download sequence
Identical sequences G3TQM8
ENSLAFP00000017870

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]