SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000018014 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000018014
Domain Number 1 Region: 102-291
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.01e-44
Family DBL homology domain (DH-domain) 0.00011
Further Details:      
 
Domain Number 2 Region: 317-436
Classification Level Classification E-value
Superfamily PH domain-like 2.44e-20
Family Pleckstrin-homology domain (PH domain) 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000018014   Gene: ENSLAFG00000022323   Transcript: ENSLAFT00000021664
Sequence length 532
Comment pep:novel supercontig:loxAfr3:scaffold_22:11096904:11098573:-1 gene:ENSLAFG00000022323 transcript:ENSLAFT00000021664 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVAHDEIGGLLPIKRTIRVLDVNNQSFREQESPSNKRVRPLARVTSLANLIYPVRNGAVR
RFGQTIQSFALSGDNRSPASAHKSYTRSTVPTPAKRRNSVLWSEMLDVSMKESLTTKEIK
RQEAIYEMSRGEQDLIEDLQLAKKAYHDPMLKLSIMSEEELTHIFGDLDAYIPLHEDLLA
RIGEATKPDGTVEQIGHILVNWLPGLNAYKVYCSNQLAAKALLDQKKQDPRVQDFLQRCL
ESPFSRKLDLWSFLDIPRSRLIKYPLLIKKFLHSKDHPDVQLLEEAYDIQEFSSDITCQY
YIDNLEYLDEKQRDPRIEASKVLLCHGELKNKNGHKLYIFLFQDILVLTRPVTRNERHSY
QVYRQPIPVQELVLEDLKDGDVRMGGSFRGAFSNSDKAKNIFRVRFQNPSPGQSHTLQAN
DVFHKQQWFNCIRTAISPFQQATSPTELKDLPELSEECEEYNLSASNVKAQRRVSTVSSV
VQVEVDENASEYGSSVQTAEDTKSVKVHRTQSEFRKARDKAQLSGKRKETLV
Download sequence
Identical sequences G3TR06
ENSLAFP00000018014 ENSLAFP00000018014

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]