SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000018185 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000018185
Domain Number 1 Region: 361-581
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.36e-53
Family DBL homology domain (DH-domain) 0.00029
Further Details:      
 
Domain Number 2 Region: 581-639
Classification Level Classification E-value
Superfamily PH domain-like 0.0000133
Family Pleckstrin-homology domain (PH domain) 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000018185   Gene: ENSLAFG00000032367   Transcript: ENSLAFT00000025532
Sequence length 640
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_26:6056248:6061461:1 gene:ENSLAFG00000032367 transcript:ENSLAFT00000025532 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDCGPPAALQPHLAEPPGPARHPVAVCQQESLSFVSLATLQPPSPVCLDLFPVTPEELRA
PGSRWSLGTPAPLQGLLWPPAPEGPDAMVSTSGGIRPSRAGSWPHCPSAQPPALEGPWSP
QHPQPQRRASHGSEKKSAWRKMRVYQHEEASSGPEAHAIFLESGQAEREQTLSMEEPRPL
ELSRPTRMGLEGAERRRFSASELMTRLHSSLRLGRNSASRALALGPGAGPAREGKPSARE
SHSVEMRMDSVLLPASVDPSEGPGSWPEPRLETQEEPVLGSRSSSERRQSRFLLNSVLYQ
EYSDVASARELRRQQREEEGPGDEAESAEEGPGPPRANLSPSSSFRAQRSARGSTFSLWQ
DIPDVRGSGVLATLSLRDCKLQEAKFELITSEASYIHSLSVAVGHFLGSAELSECLGAQD
KQWLFSKLPEVKSTSERFLQDLEQRLEADVLRFSVCDVVLRHCPAFRRVYLPYVTNQAYQ
ERTYQRLLLENPKFPGILARLEESPVCQRLPLTSFLILPFQRITRLKMLVENILKRTAQG
SEDEDMATKAFNALKELVQECNASVQSMKRTEELIHLSKKIHFEGKIFPLISQARWLVRH
GELVELAPLPAAPPAKLKLSSKAVYLHLFNDCLLLSRRKE
Download sequence
Identical sequences G3TRH7
ENSLAFP00000018185 ENSLAFP00000018185 XP_003413190.1.64505 XP_010591383.1.64505

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]