SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000019241 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000019241
Domain Number 1 Region: 11-58
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 0.000000759
Family Integrin alpha N-terminal domain 0.013
Further Details:      
 
Weak hits

Sequence:  ENSLAFP00000019241
Domain Number - Region: 36-83,271-356
Classification Level Classification E-value
Superfamily NHL repeat 0.00107
Family NHL repeat 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000019241   Gene: ENSLAFG00000001933   Transcript: ENSLAFT00000033329
Sequence length 442
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_15:47053018:47073155:1 gene:ENSLAFG00000001933 transcript:ENSLAFT00000033329 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRSVSYVQRVALEFSGSLFPHAICLGDVDNDTLNELVVGDTSGKLSMYKNDDSRPWLTCS
CQGMVSIQLTGSICPGAVRVSPTQKHTSVLPDLTNHTVLTTSGLHVAIREDRSPSEYLPE
PFFLLLQLTCVGVGDVCNKGKVRTLGNRIWNVTRWCPATITEREKCRTGFQISCPFSLVQ
VDSLSVTPGPSGIPELMVSQPGCAYAILLCTWNKDPGSPPASEGATEGSREPPAGRDVVL
HQTSGRIHNKNVSTHLIGSIKQGHSPESGASGLFALCTLDGTLKLMEEADKLLWSVQVDH
QLFALEKLDVTGNGHEEVVACAWDGQTYIIDHNRTVVRFQVDENIRAFCAGLYACKEGRN
SPCLVYVTFNQKIYVYWEVQLERMESTNLLKLLETEPEYRRLLQELGVDPDDLPAARALL
HQTLYHPDQPQQCAPSSLQDPT
Download sequence
Identical sequences G3TUI3
ENSLAFP00000019241 ENSLAFP00000001617

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]