SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000019292 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000019292
Domain Number 1 Region: 20-341
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 7.94e-77
Family Pancreatic carboxypeptidases 0.000000634
Further Details:      
 
Domain Number 2 Region: 341-419
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 2.75e-19
Family Carboxypeptidase regulatory domain 0.00068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000019292   Gene: ENSLAFG00000009332   Transcript: ENSLAFT00000035744
Sequence length 461
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_10:18197854:18225493:1 gene:ENSLAFG00000009332 transcript:ENSLAFT00000035744 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSNLFSVFLHLLLLFKLAAPVTFRHHRYDDLMRMLYKVHNECPYITRVYSIGRSVKGRHL
YVLEFSDYPGIHEPLEPEVKYVGNMHGDEVLGRELLLQLSEFLCEEFRNGNPRIIRLIEG
TRIHILPSMNPDGYEVAADQGPDNSEYLVGRNNANGVDLNRNFPDLNTYFYYNEKYGGPN
HHLPLPDNWKSQVEPETRAVIQWIRSINFILSANLHGGAVVANYPYDKSLEHRVRGFRRT
ANTPTPDDKLFQKLAKVYSYAHGWMYQGWNCGDYFPDGITNGASWYSLSKGMQDFNYLHT
NCFDITLELSCNKFPHQEELHREWLGNREALIQFLEEVHQGIKGMVFDENCNNVVGAVIS
ISGINHDVTSGDHGDYFRLLLPGTYTVTASAPGFDPETVSVTVGPAEPKQVDFHLKTSIP
QAAPTKRVPKGHGGRVLPKKVQPRAPRRKEVEKKQPRRIPA
Download sequence
Identical sequences G3TUN4
ENSLAFP00000019292 XP_003409228.1.64505 ENSLAFP00000019292

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]