SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000019323 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000019323
Domain Number 1 Region: 244-520
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.44e-77
Family Nuclear receptor ligand-binding domain 0.00000000171
Further Details:      
 
Domain Number 2 Region: 192-271
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.02e-29
Family Nuclear receptor 0.0000142
Further Details:      
 
Weak hits

Sequence:  ENSLAFP00000019323
Domain Number - Region: 165-205
Classification Level Classification E-value
Superfamily Hydrophobin II, HfbII 0.0131
Family Hydrophobin II, HfbII 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000019323   Gene: ENSLAFG00000002141   Transcript: ENSLAFT00000027080
Sequence length 526
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_105:2739246:2744695:1 gene:ENSLAFG00000002141 transcript:ENSLAFT00000027080 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSWTARPPFLPQRHAAGQCGPVGVRKEMHCGVASRWRRRRPWLDPAAAAAAAAAGEQQTP
EPEPGEAGRDGMGDSGRDSRSPDSSSPNPLPHGAPPPSPPGPPLPPSAAPPPLPPPPLGS
PFPVISSSMGSPGLPPPAPPGFSGPVSSPQINSTVSLPGGGSGPPEDVKPPVLGVRGLHC
PPPPGGPGAGKRLCAICGDRSSGKHYGVYSCEGCKGFFKRTIRKDLTYSCRDNKDCTVDK
RQRNRCQYCRYQKCLATGMKREAVQEERQRGKDKDGDGEGAGGAPEEMPVERILEAELAV
EQKSDQGVEGPGGTGGSGSSPNDPVTNICQAADKQLFTLVEWAKRIPHFSSLPLDDQVIL
LRAGWNELLIASFSHRSIDVRDGILLATGLHVHRNSAHSAGVGAIFDRSLSRVLTELVSK
MRDMRMDKTELGCLRAIILFNPDAKGLSNPSEVEVLREKVYASLETYCKQKYPEQQGRFA
KLLLRLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLEAPHQLA
Download sequence
Identical sequences G3TUR5
ENSLAFP00000001790 ENSLAFP00000019323

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]