SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000019390 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000019390
Domain Number 1 Region: 126-373
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 7.21e-68
Family Nuclear receptor ligand-binding domain 0.0000000017
Further Details:      
 
Domain Number 2 Region: 58-140
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 9.89e-29
Family Nuclear receptor 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000019390   Gene: ENSLAFG00000020911   Transcript: ENSLAFT00000036190
Sequence length 466
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_8:22457417:22486343:1 gene:ENSLAFG00000020911 transcript:ENSLAFT00000036190 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRVSEPILDMEMANYSEVLDPTYTTLEFETMQILYNSNADSSTPETTSMNTTDNGLNCLC
AICGDRATGKHYGASSCDGCKGFFRRSIRKSHVYSCRFSRQCVVDKDKRNQCRYCRLRKC
FRAGMKKEAVQNERDRISTRRNTFDGSNIPSINTLAQAEVLSRQISGSSPGASTDINVKK
IASIGDVCESMKQQLLVLVEWAKYIPAFCELPLDDQVALLRTHAGEHLLLGATKRSMVYK
DILLLGNNYVIHRNSCEVEISRVANRILDELVRPFQEIQIDDNEYACLKAIVFFDPDAKG
LSDPVKIKNMRFQVQISLEDYINDRQYDSRGRFGELLLLLPTLQSITWQMIEQIQFVKLF
GMVKIDNLLQEMLLGGASNDASHLHHPMHPHLSQDPLTGQTILISSMSTLVHPDQICKYL
GKFGYSPTPETPLPSPPQGSGQEQYKITANQASVISHQSLPKQKQL
Download sequence
Identical sequences G3TUY2
ENSLAFP00000019390 ENSLAFP00000019390

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]