SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000019478 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000019478
Domain Number 1 Region: 183-246
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000068
Family TSP-1 type 1 repeat 0.0035
Further Details:      
 
Domain Number 2 Region: 126-184
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000144
Family TSP-1 type 1 repeat 0.0055
Further Details:      
 
Weak hits

Sequence:  ENSLAFP00000019478
Domain Number - Region: 246-265
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000458
Family TSP-1 type 1 repeat 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000019478   Gene: ENSLAFG00000006120   Transcript: ENSLAFT00000034781
Sequence length 265
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_1:105461115:105468856:-1 gene:ENSLAFG00000006120 transcript:ENSLAFT00000034781 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PPWHPNKGYIKMFEIPAGARHLLIQEVDTTSHHLAVKNLETGKFILNEENNLDPNSKSFI
AMGVEWEYRNEDDRETLQTMGPLHGTITVLVIPQGDSRISLTYKYMIHEDSLNVDDNNVL
EEDSMNYEWALKKWSPCSKPCGGGSQFTKYGCRRRLDHKMVHRDFCDTVAKPKAIRRACN
PQECSQPVWVTGEWEPCSQSCGRTGMQARSVRCIQPLHDNTNRSVHTKHCNDARPEGRRA
CNRELCPGHWRAGPWSQCSVTCGNG
Download sequence
Identical sequences G3TV70
ENSLAFP00000019478

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]