SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000019644 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000019644
Domain Number 1 Region: 102-311
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.01e-54
Family DBL homology domain (DH-domain) 0.0000597
Further Details:      
 
Domain Number 2 Region: 322-395
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000107
Family Pleckstrin-homology domain (PH domain) 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000019644   Gene: ENSLAFG00000001382   Transcript: ENSLAFT00000030951
Sequence length 407
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_12:10450135:10489895:1 gene:ENSLAFG00000001382 transcript:ENSLAFT00000030951 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LVNYKRPIYLVLSKICCVKGIQRSGFRKVQEPSNKRVKPLSRVTSLANLIPPVKATPLKR
FSQTLQRSISFRSESRPDILAPRPWSRNAAPSSTKRRDSKLWSETFDVCVNQMLTSKEIK
RQEAIFELSQGEEDLIEDLKLAKKAYHDPMLKLSIMTEQELNQIFGTLDSLIPLHEDLLR
QLRDIRKPDGSTEHVGPILVGWLPCLSSYDSYCSNQVAAKALLDHKKQDHRVQDFLQRCL
ESPFSRKLDLWNFLDIPRSRLVKYPLLLREILRHTPNDNPDQQHLEEAINIIQGIVAEIN
TKTGESECRYYKERLLYLEDGQKDSLIDSSRVLCCHGELKNNRGVKLHVFLFQEVLVITR
AITHNEQLCYQLYRQPIPVKDLLLEDLQDGEVRLGGSLRGAFSNNER
Download sequence
Identical sequences G3TVN6
ENSLAFP00000019644

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]