SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000019762 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000019762
Domain Number 1 Region: 110-371
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 6.16e-64
Family Nuclear receptor ligand-binding domain 0.00000765
Further Details:      
 
Domain Number 2 Region: 55-128
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.46e-29
Family Nuclear receptor 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000019762   Gene: ENSLAFG00000007367   Transcript: ENSLAFT00000028378
Sequence length 384
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_26:24702574:24711387:1 gene:ENSLAFG00000007367 transcript:ENSLAFT00000028378 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAMVAGGWGGPGGGDTNGVDKAGGYPRAAEDDSASPPGAASDAEPGDEERPGLQVDCVVC
GDKSSGKHYGVFTCEGCKSFFKRSIRRNLSYTCRSNRDCQIDQHHRNQCQYCRLKKCFRV
GMRKEGLNDGAPPYAVPSPSLTSRISCGGSDLFPGQPVSELIAQLLRAEPYPAAGRVLGI
DNVCELAARLLFSTVEWARHAPFFPELPVADQVALLRLSWSELFVLNAAQAALPLHTAPL
LAAAGLHAAPMAAERAVAFMDQVRAFQEQVDKLGRLQVDSAEYGCLKAIALFTPDACGLS
DPAHVESLQEKAQVALTEYVRAQYPAQPQRFGRLLLRLPALRAVPASLISQLFFMRLVGK
TPIETLIRDMLLSGSTFSWAYGSG
Download sequence
Identical sequences G3TW04
ENSLAFP00000019762

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]