SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000019792 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000019792
Domain Number 1 Region: 395-614
Classification Level Classification E-value
Superfamily Bet v1-like 2.27e-40
Family STAR domain 0.0055
Further Details:      
 
Domain Number 2 Region: 4-114
Classification Level Classification E-value
Superfamily PH domain-like 1.71e-23
Family Pleckstrin-homology domain (PH domain) 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000019792   Gene: ENSLAFG00000013294   Transcript: ENSLAFT00000035980
Sequence length 623
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_7:78342359:78498775:-1 gene:ENSLAFG00000013294 transcript:ENSLAFT00000035980 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDNQSWNSSGSEEDPETESGPPVERCGVLSKWTNYIHGWQDRWVVLKNNTLSYYKSEDE
TEYGCRGICLSKAVITPHDFDECRFDISVNDSVWYLRAQDPDHRQQWIDAIEQHKTESGY
GSESSLRRHGSMVSLVSGASGYSATSTSSFKVCDYELVSDVANRSYLIVILAQLKVRINW
LILCSFILIFLNNVFYLVVEDDEDDFPTTRSDGDFLHNTNGNKEKLFPHVTPKGINGIDF
KGEAITFKATTAGILATLSHCIELMVKREDSWQKRLDKEIEKRRRIEEAYKNAMTELKKK
SHFGGPDYEEGPNSLINEEEFFDAVEAALDRQDKIEEQSQSEKVRLHWPTSLPSGDAFSS
VGTHRFVQKPYSRSSSMSSIDLVSASDDVHRFSSQVEEMVQNHMTYSLQDVGGDANWQLV
VEEGEMKVYRREVEENGIVLDPLKATHAVKGVTGHEVCNYFWNVDVRNDWETTIENFHVV
ETLADNAIIIYQTHKRVWPASQRDVLYLSAIRKIPALTENDPETWIVCNFSVDHDSAPLN
NRCVRAKINIAMICQTLVSPPEGNQEISRDNILCKITYVANVNPGGWAPASVLRAVAKRE
YPKFLKRFTSYVQEKTAGKPILF
Download sequence
Identical sequences G3TW34
ENSLAFP00000011124 ENSLAFP00000019792

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]