SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000019931 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000019931
Domain Number 1 Region: 9-68
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.000000000104
Family Protein kinases, catalytic subunit 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000019931   Gene: ENSLAFG00000005346   Transcript: ENSLAFT00000031642
Sequence length 221
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_8:45366513:45422092:-1 gene:ENSLAFG00000005346 transcript:ENSLAFT00000031642 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FSDLEPDKKAIFMIPTNPPPTFRKPELWSDDFTDFVKKCLVKSPEQRATATQLLQHHFIK
NAKPVSILRDLITEAMEIKAKRHEEQQRELEEEEENSDEDELDSHTMVKTGSESVGTMRA
TGTMSEGAQTMIEHNSMMLESDLGTMVINSEDEEEEDGTMKRNATSPQVQRPSFMDYFDK
QDFKNKSHENCNQSMHEPFPMSKNVFPDNWKVPQDGDYDFV
Download sequence
Identical sequences G3TWH3
ENSLAFP00000019931

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]