SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000020111 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000020111
Domain Number 1 Region: 422-712
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.8e-82
Family Protein kinases, catalytic subunit 0.000000000155
Further Details:      
 
Domain Number 2 Region: 921-1060
Classification Level Classification E-value
Superfamily FAT domain of focal adhesion kinase 8.37e-59
Family FAT domain of focal adhesion kinase 0.00000019
Further Details:      
 
Domain Number 3 Region: 44-143
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.14e-39
Family First domain of FERM 0.00000271
Further Details:      
 
Domain Number 4 Region: 145-266
Classification Level Classification E-value
Superfamily Second domain of FERM 1.3e-39
Family Second domain of FERM 0.000000406
Further Details:      
 
Domain Number 5 Region: 267-375
Classification Level Classification E-value
Superfamily PH domain-like 3.2e-37
Family Third domain of FERM 0.00000115
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000020111   Gene: ENSLAFG00000007270   Transcript: ENSLAFT00000029993
Sequence length 1065
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_8:84763613:84933790:-1 gene:ENSLAFG00000007270 transcript:ENSLAFT00000029993 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LTEYDRYLASSKIMAAAYLDPNLNHTPNSSTKTHLGTGMERSPGTMERVLKVFHYFESNS
EPTTWASIIRHGDATDVRGIIQKIVDSHKVKHVACYGFRLSHLLSEEVHWLHLDMGVSNV
REKYELAHPPEEWKYELRIRYLPKGFLNQFTEDKPTLNFFYQQVKSDYMLEIADQVDQEI
ALKLGCLEIRRSYWEMRGNALEKKSNYEVLEKDVGLKRFFPKSLLDSVKAKTLRKLIQQT
FRQFANLNREESILKFFEILSPVYRFDKECFKCALGSSWIISVELAIGPEEGISYLTDKG
CNPTHLADFNQVQTIQYSNSEDKDRKGMLQLKIAGAPEPLTVTAPSLTIAENMADLIDGY
CRLVNGATQSFIIRPQKEGERALPSIPKLANSEKQGVRTHAVSVSETDDYAEIIDEEDTY
TMPSTRDYEIQRERIELGRCIGEGQFGDVHQGVYMSPENPALAVAIKTCKNCTSDSVREK
FLQEALTMRQFDHPHIVKLIGVITENPVWIIMELCTLGELRSFLQMRKYSLDLASLILYA
YQLSTALAYLESKRFVHRDIAARNVLVSSPDCVKLGDFGLSRCMEDSTYYKASKGKLPIK
WMAPESINFRRFTSASDVWMFGVCMWEILMHGVKPFQGVKNNDVIGRIENGERLPMPPNC
PPTLYSLMTKCWAYDPSRRPRFTELKAQLSTILEEEKVQQEERMRMESRRQVTVSWDSGG
SDEAPPKPSRPGYPSPRSSEGFYPSPQHVVQTNHYQVSGYPGSHGITAMAGSIYPGQASL
LDQTDSWNHRPQEVSMWQPNVEDSAALDMRGIGQVLPAHLMEERLIRQQQEMEEDQRWLE
KEERFLKPDVRLSRGSIDREDGGLQGPTGNQHIYQPVGKPDPAAPPKKPPRPGAPSHLGS
LASLSSPGDSYNEGVKLQPQEISPPPTANLDRSNDKVYENVTGLVKAVIEMSSKIQPAPP
EEYVPMVKEVGLALRTLLATVDETIPVLPASTHREIEMAQKLLNSDLGGLINKMKLAQQY
VMTSLQQEYKKQMLTAAHALAVDAKNLLDVIDQARLKMLAQTRPH
Download sequence
Identical sequences G3TX03
ENSLAFP00000020111

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]