SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000020116 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000020116
Domain Number 1 Region: 41-220
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.31e-44
Family DBL homology domain (DH-domain) 0.0000381
Further Details:      
 
Domain Number 2 Region: 230-346
Classification Level Classification E-value
Superfamily PH domain-like 1.18e-33
Family Pleckstrin-homology domain (PH domain) 0.0006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000020116   Gene: ENSLAFG00000029765   Transcript: ENSLAFT00000027720
Sequence length 469
Comment pep:novel supercontig:loxAfr3:scaffold_169:688329:698233:-1 gene:ENSLAFG00000029765 transcript:ENSLAFT00000027720 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RGFCSPIFSSCHLSSVSGSISPGAAAAHGAPGGAHAQILSRLYHIMAEMVSTEREYVRSL
GYVIDNYFPEMERVDLPQDLRGKRGTIFGNLEKLHDFHRQHFLRELERCRHCPLAVGLGF
LKHEEQFRMYALYSKNKPRSDALLSSHGNAFFKAKQQALGDKMDLASYLLKPVQRMSKYA
LLLKDLVKEASRSSTQEQDLSQLQAAEDMVCFQLRHGNDLLAMDAVRGCDVNLKEQGPLR
CQDEFVVYCGRRKYLRRVFLFEDLILFSKTKKMDGGYDIYVYKQSFKTAEIGMTENVGDS
GLRFEIWFRRRRRRSQDTYILQASSAEMKTAWTSIIGRILWRQALRNRELRMREMVSMGL
GNKPFMDIKPSDAAISDRAIDYTMKGTESWSRASIAVSSFDHTTPFKRPHSTISDSSTSS
SSSQSSSVLGSLNLHVYSGLPGLLSPALWPWPYDEEELEQNTGSQPSMS
Download sequence
Identical sequences G3TX08
ENSLAFP00000020116 ENSLAFP00000020116

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]