SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000020266 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000020266
Domain Number 1 Region: 1-83
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.07e-30
Family Ras-binding domain, RBD 0.00000526
Further Details:      
 
Weak hits

Sequence:  ENSLAFP00000020266
Domain Number - Region: 147-346
Classification Level Classification E-value
Superfamily Tropomyosin 0.00458
Family Tropomyosin 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000020266   Gene: ENSLAFG00000026594   Transcript: ENSLAFT00000026992
Sequence length 419
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_2:15725211:15736363:1 gene:ENSLAFG00000026594 transcript:ENSLAFT00000026992 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELKVWVDGVQRIVCGVTEVTTCQEVVIALAQAIGRTGRYTLIEKWRDTERHLAPHENPI
ISLNKWGQYASDVQLILRRTGPSLSERPTSDSVARIPERTLYRQSLPPLAKLRPQNDKSI
KRREPKRKSLTFTGGAKGLMDIFGKSKETEFKQKVLNNCKTTADELKKLIRLQTEKLQSI
EKQLESNEVEIRFWEQKYNSSLEEEIVRLEQKIKRNDVEIEEEEFWENELQIEQENEKQL
KDQLQEIRQKITECESKLKDYLAQIQTMENGLEAEKLQWEVQEAQVNEEEVKGKIGKVKG
EIDIQGQQSLRLENGIKAVERSLGQATKRLQDKEQELEQLTKELRQVNLQQFIQQTGTKV
TVLPAEPIEVEASHADIEREAPFQSGSLKRPGSSRQLPSNLRILQNPISSGFNPEGIYV
Download sequence
Identical sequences G3TXF8
ENSLAFP00000020266 XP_003405746.1.64505 ENSLAFP00000020266

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]