SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000020342 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000020342
Domain Number 1 Region: 651-895
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.57e-65
Family Nuclear receptor ligand-binding domain 0.000000000241
Further Details:      
 
Domain Number 2 Region: 534-611
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.87e-25
Family Nuclear receptor 0.0000166
Further Details:      
 
Weak hits

Sequence:  ENSLAFP00000020342
Domain Number - Region: 365-397
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0288
Family Formin homology 2 domain (FH2 domain) 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000020342   Gene: ENSLAFG00000000445   Transcript: ENSLAFT00000034381
Sequence length 897
Comment pep:novel supercontig:loxAfr3:scaffold_24:36134542:36368162:-1 gene:ENSLAFG00000000445 transcript:ENSLAFT00000034381 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEVQLGLGRVYSRPQSKTYRGAFQNLFQSVREVIQNPGPRQPEATSAAPPGARLKQQQQQ
QQQEEISPRQQQQQQGEDGSPQAQSRGPTGYLALDKEQQPSQQPSASEGHPESGCIPEPG
AAATAGNGLPQQPPAPPEEDDSAAPSTLSLLGPTFPALSSCSADLKDILSEAGTMQLLHH
QQQQQQQQQEAVSEGSNSNGRAREAAGASISSKDGYLGGTSTISDSAKELCKAVSVSMGL
GVEALEHLSPGEHLRGDCMYAPLLGGPPPVRPTPCAPLAECKGSVLDECPGKDTEEPAEY
APFKGGYAKGLDGESLGCSGSGEAGGSGTLDLPSTLSLYKSGALDEVAAYQSRDYYNFPL
ALAGPPPPPPPPHPHARIKLENPLDYGSAWAAAAAQCRYGDLGSLHGGGAAGPGSGSPSA
AASSWHTLFTSEEGQLYGPCGGGGGSGSGVEAGTVAPYGYSRPSQGLAGQESDFPPPDVW
YPGGMVSRVPYPSPSCVKSEMGPWMESYSGPYGDVRLETARDHVLPIDYYFPPQKTCLIC
GDEASGCHYGALTCGSCKVFFKRAAEGKQKYLCASRNDCTIDKFRRKNCPSCRLRKCYEA
GMTLGARKLKKLGNLKLQEEGEVSSATSPTEEPTQKLTVSHIEGYECQPIFLNVLEAIEP
GVVCAGHDNNQPDSFAALLSSLNELGERQLVHVVKWAKALPGFRNLHVDDQMAVIQYSWM
GLMVFAMGWRSFTNVNSRMLYFAPDLVFNEYRMHKSRMYSQCVRMRHLSQEFGWLQITPQ
EFLCMKALLLFSIIPVDGLKNQKFFDELRMNYIKELDRIIACKRKNPTSCSRRFYQLTKL
LDSVQPIARELHQFTFDLLIKSHMVSVDFPEMMAEIISVQVPKILSGKVKPIYFHTQ
Download sequence
Identical sequences G3TXN4
ENSLAFP00000020342 ENSLAFP00000020342 XP_003412790.1.64505

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]