SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000020536 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000020536
Domain Number 1 Region: 7-100
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000348
Family Pleckstrin-homology domain (PH domain) 0.055
Further Details:      
 
Domain Number 2 Region: 182-223
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000787
Family Phosphotyrosine-binding domain (PTB) 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000020536   Gene: ENSLAFG00000029295   Transcript: ENSLAFT00000029349
Sequence length 308
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_43:561806:568225:1 gene:ENSLAFG00000029295 transcript:ENSLAFT00000029349 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATNFNDIVKQGYVKMKSRKLGIYRRCWLVFRKSSSKGPQRLEKYPDEKSVCLRGCPKVT
EISNVKCVTRLPKETKRQAVAIIFTDDSARTFTCDSGEQMGLQASFCPPRVGHSSDPLVG
GGQSRASHGWVLCVGPAGLRTSPAVTPSTQRCIRWGTGEPATPACVWWALQHLAPCATFV
PRMCDAGEGLYTFQTQEGEQIYQRVHSATLAIAEQHKRVLLEMEKNVRLLNKGTEHYSYP
CTPTTMLPRSAYWHHITGSQNIAEASSYAGEEYGAAQASSETDLLNRFILLKPKPSQEDS
CEAKTPSQ
Download sequence
Identical sequences G3TY78
ENSLAFP00000020536 ENSLAFP00000020536

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]