SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000020597 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000020597
Domain Number 1 Region: 45-419
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 6.02e-47
Family Integrin alpha N-terminal domain 0.013
Further Details:      
 
Domain Number 2 Region: 536-598
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000439
Family Growth factor receptor domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000020597   Gene: ENSLAFG00000003369   Transcript: ENSLAFT00000032096
Sequence length 643
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_10:20182056:20334235:1 gene:ENSLAFG00000003369 transcript:ENSLAFT00000032096 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLGMSLFLLLLGLLPPTEGSQRAEPMFTAVTNSVLPPDYDSNPTQLNYGVAVTDVDHDGD
FEIVVAGYNGPNLVLKYDRTLKRLVNIAVDERSSPYYALRDRQGNAIGVTACDIDGDGRE
EIYFLNTNNAFSGVATYSDKLFKFRNNRWEDILSDEVNVARGVASLFAGRSVACVDRTGS
GRYSIYIANYAYGNVGPDALIEMDPEASDLSRGILALRDVAAEAGVSKYTGGRGVSVGPI
LSSSASDIFCDNENGPNFLFHNRGDGTFVDAAASAGVDDPHQHGRGVALADFNRDGKVDI
VYGNWNGPHRLYLQMNVHGKVRFRDIASPKFSMPSPVRTVIAADFDNDQELEVFFNNIAY
RSSSANRLFRVIRREHGDPLIEELNPGDALEPEGRGTGGVVTDFDGDGMLDLILSHGESM
AQPLSVFRGNQGFSNNWLRVVPRTRFGAFARGAKVVLYTKRSGAHLRIIDGGSGYLCEME
PVAHFGLGKDEASSVEVTWPDGKMVSRSVASGEMNSVLEIPYPRDEDKFQDPAPLECGQG
FSQQENGHCMDTNECIQFPFVCPRDKPVCVNTYGSYRCRTNKRCSQGYEPNEDGTACVGT
FGQSPGRRSTTPTTAAAAAAAAAAAGAATAAPVLVDGDLDLGS
Download sequence
Identical sequences G3TYD9
ENSLAFP00000020597

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]