SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000020608 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000020608
Domain Number 1 Region: 70-206
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 3.27e-38
Family Regulator of G-protein signaling, RGS 0.00000514
Further Details:      
 
Domain Number 2 Region: 740-820
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.89e-27
Family DIX domain 0.0000895
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000020608   Gene: ENSLAFG00000013628   Transcript: ENSLAFT00000027196
Sequence length 820
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_49:14636058:14665078:-1 gene:ENSLAFG00000013628 transcript:ENSLAFT00000027196 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSAALVTRLPDPSSSFREDAPRPPVPGEEGETPPCQAGLGKGQVTKPMPVSSNTRRNED
GLGEPEGRASPDSPLTRWTKSLHSLLGDQDGAYLFRTFLEREKCVDTLDFWFACNGFRQM
NLKDTKTLRVAKAIYKRYIENNSIVSKQLKPATKTYIRDGIKKQQIDSIMFDQAQTEIQS
VMEENAYQMFLTSDIYLEYVRSGGENTAYMSSGGLGSLKVVCGYLPTLNEEEEWTCADFK
CKLSPTVVGLSSKTLRATANVRSTEAVENGYRSFKRSDSVNPYHVGSGYVFAPATSANDS
EISSDALTDDSMSMTDSSVDGIPPYRVGSKKQLQREMHRSVKANGQVSLPHFPRTHRLPK
EMTPVEPAIFAAELISRLEKLKLELESRHSLEERLQQIREVVLGRHLHPWAGAREESIHL
RTGHRQRGAVVPSCSPVTSSPSRMREGGYYCYASARATPRCRSRCRGSHLGECWQILLPQ
FGLLPASALGRSEMGSVVTHLASRREAEGRWEGGWAAGASCHHPHRASHLRSCKNGVSGL
VWFLVPYSSSRGSTLPKRSGKGTEPGLALPIREGGAPGGAGAPQLPGEEGDRSQDVWQWM
LESERQSKAKPHSAQSTKKAYSGESARVASSERAGRHHLWGASNGHPRTVPRAHPFTQDP
AMPPLTPPNTLAQLEEACRRLAEVSKPSKQRCCVASQQRDRNHPAPGQAGTTPFSTPALA
PEDHKEPKKLAGVHPLQASELVVTYFFCGEEIPYRRMLKAQSLTLGHFKEQLSKKGNYRY
YFKKASDEFACGAVFEEIWDDDTMLPMYEGRILGKVERID
Download sequence
Identical sequences G3TYF0
ENSLAFP00000020608 ENSLAFP00000011407

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]