SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000020688 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000020688
Domain Number 1 Region: 134-206
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 5.1e-29
Family Nuclear receptor 0.0000149
Further Details:      
 
Domain Number 2 Region: 393-449
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 0.00000000000000878
Family Nuclear receptor ligand-binding domain 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000020688   Gene: ENSLAFG00000012239   Transcript: ENSLAFT00000036956
Sequence length 455
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_190:313623:337169:1 gene:ENSLAFG00000012239 transcript:ENSLAFT00000036956 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VDSCLADFSTQVNSSSLNSPTGRGPMAAPSLHPPLGPGVGSSLGSPGQLHSPISTLNSPI
NGMGPPFSVISSPMGPHSMSVPTAPALGFGSGSPQLSSPMNLVSSTEDIKPPLGLNGVLK
VPAHPSGNMASFTKHICAICGDRSSGKHYGVYSCEGCKGFFKRTVRKDLTYTCRDNKDCL
IDKRQRNRCQYCRYQKCLAMGMKREELGPATSQGPSRGQGPVGGAPSHPGDCRTNLQSSP
ALCPGPRVTPRGLQSQPSAQPCSVSRVSCTGFVWPHTLLLWACRPPSINKTIIFTTMLLR
AAGLLVASKPGRERPGQTGLLRSGGIGAARSQPLPMGVGSIKESFAVVTPCCCSGARWSQ
PHRGALCSVLLYPPESRGWAWGSPLPSLHEAPLDPQMTHRVTGGPPLFAKLLLRLPALRS
IGLKCLEHLFFFKLIGDTPIDTFLMEMLEAPHQMT
Download sequence
Identical sequences G3TYN0
ENSLAFP00000020688 ENSLAFP00000010226

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]