SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000020813 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000020813
Domain Number 1 Region: 925-1261
Classification Level Classification E-value
Superfamily NHL repeat 6.28e-23
Family NHL repeat 0.0028
Further Details:      
 
Domain Number 2 Region: 1163-1376
Classification Level Classification E-value
Superfamily Soluble quinoprotein glucose dehydrogenase 0.00000000116
Family Soluble quinoprotein glucose dehydrogenase 0.036
Further Details:      
 
Domain Number 3 Region: 619-693
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.00000053
Family Pre-dockerin domain 0.073
Further Details:      
 
Weak hits

Sequence:  ENSLAFP00000020813
Domain Number - Region: 370-394
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000471
Family EGF-type module 0.04
Further Details:      
 
Domain Number - Region: 436-460
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000471
Family Integrin beta EGF-like domains 0.051
Further Details:      
 
Domain Number - Region: 466-491
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000607
Family EGF-type module 0.04
Further Details:      
 
Domain Number - Region: 493-532
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00191
Family EGF-type module 0.06
Further Details:      
 
Domain Number - Region: 302-329
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0022
Family Integrin beta EGF-like domains 0.046
Further Details:      
 
Domain Number - Region: 337-361
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00419
Family Integrin beta EGF-like domains 0.049
Further Details:      
 
Domain Number - Region: 272-296
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00885
Family EGF-type module 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000020813   Gene: ENSLAFG00000015906   Transcript: ENSLAFT00000035269
Sequence length 2461
Comment pep:novel supercontig:loxAfr3:scaffold_37:20354250:20556687:1 gene:ENSLAFG00000015906 transcript:ENSLAFT00000035269 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSHRHFLFKTGTGTTPLFSTATPGYTMASGSVYSPPTRPLPRNTLSRSAFKFKKSSKYCS
WKCTALCAVGVSVLLAILLSYFIAMHLFGLNWQLQQTENDTFENGKRNSVAGSYQASSLP
SGKLSGFTQENNTIDSGELDIGRRAIQEVPPGIFWRSQLFIDQPQFLKFNISLQKDALIG
VYGRKGLPPSHTQYDFVELLDGSRLIAREQRNLLESERAGRQARSVSLHEAGFIQYLDSG
IWHLAFYNDGKNAEQVSFNTIVIESVVECPRNCHGNGECVSGTCHCFPGFLGPDCSRAAC
PVLCSGNGQYSKGRCQCFSGWKGTECDVPTTQCIDPQCGGRGICIMGSCACNSGYKGENC
EEADCLDPGCSNHGVCIHGECHCNPGWGGNNCELLKTMCPDQCSGHGTYLQESGSCTCDP
NWTGPDCSNEICSVDCGSHGVCMGGTCRCEEGWTGPACNQRACHPRCAEHGTCKDGTCEC
SQGWNGEHCTIEGCPGLCNSNGRCTLDQNGWHCVCQPGWRGAGCDVAMETLCTDSKDNEG
ADGLIDCMDPDCCLQSSCQNQPYCRGLPDPQDVISQSLQSPSQQAAKPFYDRISFLIGSD
STHVIPGESPFNKSLASVIRGQVLTADGTPLIGVNVSFLHYPEYGYTITRQDGMFDLVAN
GGASLTLVFERSPFLTQYHTVWIPWSVFYVMDTLVMKKEENDIPSCDLSGFVRPNPVIVS
SPLSTFFRSSPEDSPIIPETQNMHCYIKISSYFLKMDSALKDRTLGTITMLWLDLLFSLM
ENNMIKLKVLISLQGIILKIKFKASPNLAYTFIWDKTDAYNQKVYGLSEAVVSVGYEYES
CLDLTLWEKRTAILQGCELDASNMGGWTLDKHHVLDVQNGILYKGNGENQFISQQPPVVS
SVMGNGRRRSISCPSCNGQADGNKLLAPVALACGIDGSLYVGDFNYVRRIFPSGNVTSVL
ELRNKDFRHSSNPAHRYYLATDPVTGDLYVSDTNTRRIYRPKSLTGAKDLTKNAEVVAGT
GEQCLPFDEARCGDGGKAVEATLMSPKGKGMAVDKNGLIYFVDGTMIRKVDQNGIISTLL
GSNDLTSARPLTCDTSMHISQVRLEWPTDLAINPMDNSIYVLDNNVVLQITENRQVRIAA
GRPMHCQVPGVEYSAGKHAVQTTLESATAIAVSYSGVLYITETDEKKINRIRQVTTDGEI
SLVAGIPSECDCKNDANCDCYQSGDGYAKDAKLSAPSSLAASPDGTLYVADLGNIRIRAV
SENKPLLNSMNCYEVASPTDQELYIFDINGTHQYTVSLVTGEYLYNFSYSNDNDITAVTD
SSGNTLRIRRDPNRMPVRVVSPDNQVIWLTIGTNGCLKSMTAQGLELVLFTYHGNSGLLA
TKSDETGWTTFFDYDSEGRLTNVTFPTGVVTSLHGDMDKAITVDVESSSREEDVSITSNL
SSIDSFYTMVQDQLRNSYQIGYDGSLRIIYASGLDSHYQTEPHVLAGTANPTVAKRNMTL
PGENGQNLVEWRFRKEQAQGKVNVFGRKLRVNGRNLLSVDFDRTTKTEKIYDDHRKFLLR
IAYDTSGHPTLWLPSSKLMAVNVTYSSTGQIASIQRGTTSEKVDYDGQGRIVSRVFADGK
TWSYTYLEKSMVLLLHSQRQYIFEYDMWDRLSAITMPSVARHTMQTIRSIGYYRNIYNPP
ESNASIITDYNEEGLLLQTAFLGTSRRVLFKYRRQTRLSEILYDSTRVSFTYDETAGVLK
TVNLQSDGFICTIRYRQIGPLIDRQIFRFSEDGMVNARFDYSYDNSFRVTSMQGVINETP
LPIDLYQFDDISGKVEQFGKFGVIYYDINQIISTAVMTYTKHFDAHGRIKEIQYEIFRSL
MYWITIQYDNMGRVTKREIKIGPFANTTKYAYEYDVDGQLQTVYLNEKIMWRYNYDLNGN
LHLLNPSNSARLTPLRYDLRDRITRLGDVQYRLDEDGFLRQRGTEIFEYSSKGLLTRVYS
KGSGWTVIYRYDGLGRRVSTKTSLGQHLQFFYADLTYPTRITHVYNHSSSEITSLYYDLQ
GHLFAMEISSGDEFYIASDNTGTPLAVFSSNGLMLKQIQYTAYGEIYFDSNIDFQLVIGF
HGGLYDPLTKLIHFGERDYDILAGRWTTPDIEIWKRIGKDPAPFNLYMFRNNNPASKIHD
VKDYITDVNSWLVTFGFHLHNAIPGFPVPKFDLTEPSYELVKSQQWDDVPPIFGVQQQVA
RQAKAFLSLGKMAEVQVSRRKAGGEQSWLWFATVKSLIGKGVMLAVSQGRVQTNVLNIAN
EDCIKVAAVLNNAFYLENLHFTIEGKDTHYFIKTTTPESDLGTLRLTSGRKALENGINVT
VSQSTTVVNGRTRRFADVEMQFGALALHVRYGMTLDEEKARILEQARQRALARAWAREQQ
RVRDGEEGARLWTEGEKRQLLSAGKVQGYDGYYVLSVEQYPELADSANNIQFLRQSEIGK
R
Download sequence
Identical sequences G3TZ05
ENSLAFP00000020813

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]