SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000021253 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000021253
Domain Number 1 Region: 82-223
Classification Level Classification E-value
Superfamily PH domain-like 6.03e-32
Family Pleckstrin-homology domain (PH domain) 0.00000142
Further Details:      
 
Domain Number 2 Region: 237-357
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 4.76e-28
Family PLC-like (P variant) 0.0061
Further Details:      
 
Domain Number 3 Region: 4-82
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 7.85e-26
Family DBL homology domain (DH-domain) 0.0000158
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000021253   Gene: ENSLAFG00000032314   Transcript: ENSLAFT00000036469
Sequence length 367
Comment pep:novel supercontig:loxAfr3:scaffold_20:36895791:36904442:-1 gene:ENSLAFG00000032314 transcript:ENSLAFT00000036469 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KLASDPRCKGMPLSSFLLKPMQRITRYPLLIRSILENTPESHVDHSSLKLALERAEELCS
QVNEGVREKENSDRLEWIQAHVQCEGLAEQLIFNSLTNCLGPRKLLHSGKLYKTKSNKEL
HGFLFNDFLLLTYMVKQFAVSSGSEKLFSSKSNAQFKMYKTPIFLNEVLVKLPTDPSSDE
PVFHISHIDRVYTLRTDNINERTAWVQKIKAASEQYIDTEKKKREKAYQARSQKTSGIGR
LMVHVIEATELKACKPNGKSNPYCEISMGPQSYTTRTLQDTLNPKWNFNCQFFIKDLYQD
VLCLTMFDRDQFSPDDFLGRTEVPVAKIRTEQDSKGPTTRRLLLHEVPTGEVWVRFDLQL
FEQKNLL
Download sequence
Identical sequences G3U095
ENSLAFP00000021253 ENSLAFP00000021253

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]