SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000021338 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000021338
Domain Number 1 Region: 489-654
Classification Level Classification E-value
Superfamily A middle domain of Talin 1 1.12e-71
Family A middle domain of Talin 1 0.0000000351
Further Details:      
 
Domain Number 2 Region: 754-889
Classification Level Classification E-value
Superfamily I/LWEQ domain 1.94e-53
Family I/LWEQ domain 0.00000024
Further Details:      
 
Domain Number 3 Region: 2295-2486
Classification Level Classification E-value
Superfamily I/LWEQ domain 6.28e-51
Family I/LWEQ domain 0.00011
Further Details:      
 
Domain Number 4 Region: 659-783
Classification Level Classification E-value
Superfamily I/LWEQ domain 4.84e-48
Family I/LWEQ domain 0.000000521
Further Details:      
 
Domain Number 5 Region: 1841-1973
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 1.83e-46
Family VBS domain 0.000000488
Further Details:      
 
Domain Number 6 Region: 1225-1361
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 2.04e-38
Family VBS domain 0.014
Further Details:      
 
Domain Number 7 Region: 1075-1207
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 1.05e-26
Family VBS domain 0.029
Further Details:      
 
Domain Number 8 Region: 310-400
Classification Level Classification E-value
Superfamily PH domain-like 1.84e-25
Family Third domain of FERM 0.00000848
Further Details:      
 
Domain Number 9 Region: 195-309
Classification Level Classification E-value
Superfamily Second domain of FERM 4.32e-25
Family Second domain of FERM 0.00000277
Further Details:      
 
Domain Number 10 Region: 1410-1555
Classification Level Classification E-value
Superfamily I/LWEQ domain 0.000000000000562
Family I/LWEQ domain 0.0076
Further Details:      
 
Domain Number 11 Region: 79-136
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000183
Family First domain of FERM 0.033
Further Details:      
 
Domain Number 12 Region: 1695-1814
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.00000298
Family VBS domain 0.027
Further Details:      
 
Domain Number 13 Region: 2010-2132
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.000011
Family VBS domain 0.033
Further Details:      
 
Weak hits

Sequence:  ENSLAFP00000021338
Domain Number - Region: 1598-1658
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.00314
Family VBS domain 0.072
Further Details:      
 
Domain Number - Region: 2100-2227
Classification Level Classification E-value
Superfamily I/LWEQ domain 0.0523
Family I/LWEQ domain 0.0056
Further Details:      
 
Domain Number - Region: 950-1042
Classification Level Classification E-value
Superfamily I/LWEQ domain 0.1
Family I/LWEQ domain 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000021338   Gene: ENSLAFG00000002460   Transcript: ENSLAFT00000029798
Sequence length 2541
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_6:64635766:64660194:1 gene:ENSLAFG00000002460 transcript:ENSLAFT00000029798 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVALSLKISIGNVVKTMQFEPSTMVYDACRIIRERIPEALAGPPSDFGLFLSDDDPKKGI
WLEAGKALDYYMLRNGDTMEYRKKQRPLKIRMLDGTVKTIMVDDSKTVTDMLMTICARIG
ITNHDEYSLVRELMEEKKEEVTGTLRKDKTLLRDEKKMEKLKQKLHTDDELNWLDHGRTL
REQGVEEHETLLLRRKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFDKACEFAG
FQCQIQFGPHNEQKHKAGFLEDWPTWLPSPICLFTGPVCNMNAHKNCGQMSEIEAKVRYV
KLARSLKTYGVSFFLVKEKMKGKNKLVPRLLGITKECVMRVDEKTKEVIQEWNLTNIKRW
AASPKSFTLDFGDYQDGYYSVQTTEGEQIAQLIAGYIDIILKKKKSKDHFGLEGDEESTM
LEDSVSPKKSTVLQQQYNRIGKVEHGSVALPAIMRSGASGPENFQMGSMPPAQQQITSGQ
MHRGHMPPLTSAQQALTGTINSSMQAVQAAQATLDDFDTLPPLGQDAASKAWRKNKMDES
KHEIHSQVDAITAGTASVVNLTAGDPAETDYTAVGCAVTTISSNLTEMSRGVKLLAALLE
DEGGSGRPLLQAAKGLAGAVSELLRSAQPASAEPRQNLLQAAGNVGQASGELLQQIGESD
TDPHFQDMLMQLAKAVASAAAALVLKAKSVAQRTEDAGLQTQVIAAATQCALSTSQLVAC
TKVVAPTISSPVCQEQLVEAGRLVAKAVEGCVSASQAATEDGQLLRGVGAAATAVTQALN
ELLQHVRAHATGAGPAGRYDQATDTILTVTENIFSSMGDAGEMVRQARILAQATSDLVNA
IKADAEGESDLENSRKLLSAAKILADATAKMVEAAKGAAAHPDSEEQQQRLREAAEGLRM
ATNAAAQNAIKKKLVQRLEHAAKQAAASATQTIAAAQHAASTPKVSAGPQPLLVQSCKAV
AEQIPLLVQGVRGSQAQPDSPKRTGHLICLSVPQQPGGKMVAAAKASVPTIQDQASAMQL
SQCAKNLGTALAELRTAAQKAQEACGPLEMDSALSVVQNLEKDLQEVKAAARDGKLKPLP
GETMEKCVQDLGNSTKAVSSAIAQLLGEVAQGNENYAGIAARDVAGGLRALAQAARGVAA
LTSDPAVQAIVLDTASDVLDKASSLIEEAKKAAGHPGDPESQQRLAQVAKAVTQALNRCV
SCLPGQRDVDNALRAVGDASKRLLSDSLPPSTGTFQEAQSRLNEAAAGLNQAATELVQAS
RGTPQDLARASGRFGQDFSTFLEAGVEMAGQAPSKEDRAQVVSNLKGISMSSSKLLLAAK
ALSTDPASPNLKSQLAAAARAVTDSINQLITMCTQQAPGQKECDNALRELETVRELLENP
VQPINDMSYFGCLDSVMENSKVLGEAMTGISQNAKNGNLPEFGEAIATASKALCGFTEAA
AQAAYLVGVSDPNSQAGQQGLVEPTQFARANQAIQMACQSLGEPGCTQAQVLSAATIVAK
HTSALCNSCRLASARTTNPTAKRQFVQSAKEVANSTANLVKTIKALDGAFTEENRAQCRA
ATAPLLEAVDNLSAFASNPEFSSIPAQISPEGRAAMEPIVISAKTMLESAGGLIQTARAL
AVNPRDPPRWSVLASHSRTVSDSIKKLITSMRDKAPGQLECESAITALNSCLRDLDQASL
AAVSQQLAPREGISQEALHTQMLTAVQEISHLIEPLAGAARAEASQLGHKVSQMAQYFEP
LTLAAVGAASKTLSHPQQMALLDQTKTLAESALQLLYTAKEAGGNPKQAAHTQEALEEAV
QMMTEAVEDLTTTLNEAASAAGVVGGMVDSITQAINQLDEGPMGEPEGSFVDYQTTMVRT
AKAIAVTVQEMVTKSNTNPEELGPLANQLTSDYGRLASQAKPAAVAAENEEIGSHIKHRV
QELGHGCSALVTKAGALQCSPSDAYTKKELIECARRVSEKVSHVLAALQAGNRGTQACIT
AASAVSGIIADLDTTIMFATAGTLNREGAETFADHREGILKTAKVLVEDTKVLVQNAAGS
QEKLAQAAQSSVATITRLADVVKLGAASLGAEDPETQVVLINAVKDVAKALGDLISATKA
AAGKVGDDPAVWQLKNSAKVMVTNVTSLLKTVKAVEDEATKGTRALEATTEHIRQELAVF
CSPEPPAKTSTPEDFIRMTKGITMATAKAVAAGNSCRQEDVIATANLSRRAIADMLRACK
EAAYHPEVAPDVRLRALHYGRECANGYLELLDHVLLTLQKPSPELKQQLTGHSKRVAGSV
TELIQAAEAMKGTEWVDPEDPTVIAENELLGAAAAIEAAAKKLEQLKPRAKPKEADESLN
FEEQILEAAKSIAAATSALVKAASAAQRELVAQGKVGAIPANALDDGQWSQGLISAARMV
AAATNNLCEAANAAVQGHASQEKLISSAKQVAASTAQLLVACKVKADQDSEAMKRLQAAG
NAVKRASDNLVKAAQKAAAFEEQENETVVVKEKMVGGIAQIIAAQEEMLRKERELEEARK
KLAQIRQQQYKFLPSELRDEH
Download sequence
Identical sequences G3U0I0
ENSLAFP00000021338

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]