SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000021385 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000021385
Domain Number 1 Region: 1054-1265
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 6.8e-54
Family DBL homology domain (DH-domain) 0.00022
Further Details:      
 
Domain Number 2 Region: 1731-1970
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.00000000000366
Family WD40-repeat 0.013
Further Details:      
 
Domain Number 3 Region: 1257-1354
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000664
Family Pleckstrin-homology domain (PH domain) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000021385   Gene: ENSLAFG00000000317   Transcript: ENSLAFT00000026167
Sequence length 2055
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_79:4087330:4145636:-1 gene:ENSLAFG00000000317 transcript:ENSLAFT00000026167 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LYRSVSFLLERWSGGTRAEEEEVVDTPELRRRSCRPSAAGPGQPSRRVSKLASGPPATPA
QPRQLRSLSPSVRQLSRRFDAPRLNDDSAEARDGGVSPGAVEEAAEVAARGSWPSVTEMR
KLFGGPGSRRPCADSEALGTPSPDGAAWEPQTREPRQPPTPPPRTCFPLAGLRSVRPLPG
PGVEGRRRQQQQERAQRPADGLHSWHSFSLPQAGARASCSSSSSIASSYPVSRSRAASSS
EEEEEAPPPTTTTTGAQNPAYHGGHSSGSDEDRDGEGSHRWGGRQGPTPGNARLGRDCSL
DRDGLSLGSMDSAGGGRRSPEPPTSPRAPSEERSREWGTGTPPCTLGPQEGLRPMPDAVG
GAFRVAKVSFPAYLASPAGSRGSSRYSSTETLKDEDLWSSRGLGGWGVYRSPSFGAGEGL
LLRSQARTRAKGPVGTMRALRDGGLELDKNRQRKSLSNPDIASETLTLLSFLRSDLSELR
IRKAGRHPGDPESDPLDGRDSPTAGGPVGQLGPMPDPVPASPGTRPTLKDLTATLRRAKS
FTCSEKPMACRLPRASTLKPSSSELLLAGSGSEEDPLPLVVQDQYVQEARQVFEKIQRMG
AQQDDGSNAPPGSPDWAGDMTRGQRSQEELSGPESSLTDEGIGADPEPPVSTLCSLGSAG
VWRPLSSSSAQTNHHGSGTGDSLGGWALVSPEAPPTPGTIRRRRKVPPSGPGGTELSNGE
AGEAYRSLSDPIPQRHRTATSEEPSGFSVDSNLLGSLGPKTGLPVAPAVDEGLTSGHSDW
SVGSEGSKGYQDVIQSIVQGPGALGRVVDDRTAGKAPKKKSLSDPSRRGELAGPGFEGPG
GEPIREVELVLPPSSSEPILAEERAEPQELSPARGRAQSERALPEAPPAPATAHCGFHLD
PKLADILSPRLIRRGSKKRPARSSHQELRREEGHQDQTGSLSRARPTSKHVRHASVPATF
TPIVMPEPPTSVRPPVAVPEPMGFPARTHPALQAPSLEDVTKQYMLTLHSGEVPAPGPVD
MPCLARLSPPSDEAKPPEAARAPHEPAPASKCCSKPQVDMRKHVTMTLLDTEQSYVESLR
TLMQGYMQPLKQPENLLCDPSLVDEIFNQIPELLEHHEQFLEQVRHCVQTWHAQQKVGDL
LVQSFSKDVLVNIYSAYIDNFLNAKDAVRVAKESRPAFLKFLEQNMRENKEKQALSDLMI
KPVQRIPRYELLVKDLLKHTPKDHPDYPLLLDAQRNIKQVAERINKGVRSAEEAERHARV
LQEIEAHIEGMEDLQAPLRRFLRQEMVIEVKAVGGKKDRSLFLFTDLIVCTTLKRKSGSL
RRSSMSLYTAASVIDTASKYKLLWKLPLEDADIIKGASQATNRENIQKAISRLDEDLTTL
GQMSKLSENIGFPHQSLDDTLRDLSAAMHRDLSEKQALCYALSFPPTKLELCATRPEGTD
SFIFEFPHPDARLGFEQAFDEAKRKLASSKSCLDPEFLKAIPIMKTRSGMQVICTEITSV
SFCPEPTPGGLCNSDGYVGPGVILLSLRAEPERPCIAVCSARILCIGAPGLQRRCNRERP
SSLRSPPETAPEPTGPELDAEVAVDEEAPALAEPGPQPCLHISIAGSGLEMAPGPAEGDP
RPELVPFDSDSDDESSPSPSGTLQSQASRSTISSSFGNEETPSSKEAMAETTSSEEEQEP
GFLPLSGSFGPGGPCSTSPMDGRALRRSSRGSFTRGSLEDLLSVDPEAFQSSVWLGTEDG
CVHVYQSSESIRDRRNSMKLQHAASVTCILYLNNQVFVSLANGELVIYQREAGHFWDPQN
FKSVTLGAQGSPITKMVSVGGRLWCGCQNRVLVLSPDTLQLEHTFYVGQDSSRSVACMVD
SSLGVWVTLKGSAHVCLYHSDTFEQLAEVDVTPPVHRMLAGSDAIIRQHKAACLRITALL
VCEELLWVGTSAGVVLTMPTSPSTVSCPRAPLSPAGLGQGHTGHVRFLAAVQLPDGFNLL
CPTPPPPLDTGPEKLPSLEHQDSPRHRGPASARPKMLVISGGDGYEDFRLSSGAGSSSET
VGRDDSTNHLLLWRV
Download sequence
Identical sequences G3U0M7
ENSLAFP00000021385 ENSLAFP00000021385

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]