SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000021509 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000021509
Domain Number 1 Region: 132-244
Classification Level Classification E-value
Superfamily PH domain-like 6.39e-34
Family Phosphotyrosine-binding domain (PTB) 0.00000655
Further Details:      
 
Domain Number 2 Region: 7-110
Classification Level Classification E-value
Superfamily PH domain-like 5.48e-18
Family Phosphotyrosine-binding domain (PTB) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000021509   Gene: ENSLAFG00000030432   Transcript: ENSLAFT00000028512
Sequence length 306
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_75:4629367:4835985:1 gene:ENSLAFG00000030432 transcript:ENSLAFT00000028512 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASNFNDIVKQGYVRIRSRRLGIYQRCWLVFKKASSKGPKRLEKFSDERAAYFRCYHKVT
ELNNVKNVARLPKSTKKHAIGIYFNDDTSKTFACESDLEADEWCKVLQMECIGTRINDIS
LGEPDLLATGVEREQSERFNVYLMPSPNLDVHGECALQITYEHICLWDIQNPRVKLISWP
LSALRRYGRDATWFTFEAGRMCETGEGLFIFQTRDGEAIYQKVHSAALAIAEQHERLLQS
VKNSMLQMKMSERAASLSTMVPLPRSAYWQHITRQHSTGQLYRLQDVTSPLKLHRTETFP
AYRSEH
Download sequence
Identical sequences G3U101
XP_003419950.1.64505 ENSLAFP00000021509 ENSLAFP00000021509

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]