SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000021856 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000021856
Domain Number 1 Region: 425-658
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 4.71e-45
Family DBL homology domain (DH-domain) 0.00035
Further Details:      
 
Domain Number 2 Region: 131-274
Classification Level Classification E-value
Superfamily PH domain-like 2.37e-41
Family Third domain of FERM 0.00024
Further Details:      
 
Domain Number 3 Region: 767-926
Classification Level Classification E-value
Superfamily PH domain-like 9.59e-28
Family Pleckstrin-homology domain (PH domain) 0.0044
Further Details:      
 
Domain Number 4 Region: 31-133
Classification Level Classification E-value
Superfamily Second domain of FERM 1.16e-27
Family Second domain of FERM 0.00011
Further Details:      
 
Domain Number 5 Region: 644-766
Classification Level Classification E-value
Superfamily PH domain-like 1.41e-27
Family Pleckstrin-homology domain (PH domain) 0.0091
Further Details:      
 
Weak hits

Sequence:  ENSLAFP00000021856
Domain Number - Region: 1-30
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0114
Family First domain of FERM 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000021856   Gene: ENSLAFG00000005242   Transcript: ENSLAFT00000032582
Sequence length 927
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_11:6855421:6965299:-1 gene:ENSLAFG00000005242 transcript:ENSLAFT00000032582 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VWLDLLKPIVKQIRRPKHVVVKFVVKFFPPDHAQLQEELTRYLFALQVKQDLAQGRLTCN
DTSAALLISHIVQSEIGDFDEALDREHLAKNKYIPQQDALEDKIVEFHHNHIGQTPAESD
FQLLEIARRLEMYGIRLHPAKDREGTKINLAVANTGILVFQGFTKINAFNWAKVRKLSFK
RKRFLIKLRPDANSSYQDTLEFLMASRDFCKSFWKICVEHHAFFRLFEEPKPKPKPVLFS
RGSSFRFSGRTQKQVLDYVKEGGHKKVQFESETRHCKNLLSSESLNGSPRLPRHSSLIDE
MFRGSGDHSPLATPLSPSSRSSSPGMRKSKTSHSDLLPPTTPEKRWTRASRTKGSISKDG
SESMESHAPGTVTSHPQTGSLTGSPHLSELSVNSQGGAAPANVTLSPNLSPDTKQASPLV
SPLLNDQACPRTDDEEEVRRKRFPTDKAYFIAKEVSTTERTYLKDLEVITSWFQSTVSKE
DSMPETLKSLIFPNFEPLHKFHTSFLKEIEQRLALWEGRSNAHIQGDYQRIGDVMLKNIQ
GMKPLAVHLWKHNEALEGLENGIKGSRRLENFCRDFELQKVCYLPLNTFLLRPLHRLMHY
KQVLERLCKHHPPSHADFRDCRAALAEITEMVAQLHGTMIKMENFQKLHELKKDLIGVDN
LVIPGREFIRLGSLSKLSGKGLQQRMFFLFNDVLLYTSRGLTASNQFKVHGQLPLYGMTI
EESEDQWGVPHCLTLRGQRQSIIVAASSRSEMQKWVEDIQMAIDLAEKSSGPTPELLASS
PPDNKSPEEGMAVDQESEDDLSASRTSLERQAPHRGNTMVHVCWHRNTSVSMVDFSIAVE
NQLSGNLLRKFKNSNGWQKLWVVFTNFCLFFYKSHQDSHPLASLPLLGYSLTVPSESENI
HKDYVFKLHFKSHVYYFRAESEYTFDR
Download sequence
Identical sequences G3U1Z8
ENSLAFP00000021856

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]