SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000021911 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000021911
Domain Number 1 Region: 236-472
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 4.45e-55
Family DBL homology domain (DH-domain) 0.0000368
Further Details:      
 
Domain Number 2 Region: 471-594
Classification Level Classification E-value
Superfamily PH domain-like 1.5e-30
Family Pleckstrin-homology domain (PH domain) 0.0032
Further Details:      
 
Domain Number 3 Region: 38-106
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0000000000284
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000021911   Gene: ENSLAFG00000010529   Transcript: ENSLAFT00000031495
Sequence length 607
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_28:21760838:21805811:-1 gene:ENSLAFG00000010529 transcript:ENSLAFT00000031495 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVKWGRFHEVPVITVRFIGPKHGEVRALTSNKHRKRQASSLREEHEEKTLNGHTFGSIP
VVGPINCSQCMKPFTNRDAYTCANCGAFVHKGCRESLASCAKVKMKQPKGSLQAHDTSSL
PTVIMRNKPSQPKERPRSAVLLADETTAAPVFANRRSQQSVSLSKSVSIQNIAGVGNDES
MSNTWKFLSHSTDSLNKISKVNESTESLTDEGVGTDMNEGQLMGDFEIESKQLEAESWSR
IVDSKFLKQQKKDVIKRQEVIYELMQTELHHVRTLKIMSDVYSRGMMTDLLFEQQMVEKL
FPCLDELISIHSQFFQRILERKKESLVEKSEKNFLIRRMGDVLVNQFSGENAERLKKTYG
KFCGQHTQSVNYFKDLYTKDKRFQAFVKKKMSSSVVRRLGIPECILLVTQRITKYPVLFQ
RMLQYTKDNEVEEEDLAQSLSLVKDVIGAVDSKVASYEKKVRLIEIYTKTDSKSIMRMKS
GQMFAKEDLKRKKLVRDGSVFLKNMAGRLKEVQAVLLTDILVFLQEKDQKYVFASLDQKS
TVISLKKLIVREVAHEEKGLFLISMGMKDPEMVEVHASSKEERNSWIHIIQDTMAALNRD
EDEGIPS
Download sequence
Identical sequences G3U253
ENSLAFP00000021911

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]