SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000021940 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000021940
Domain Number 1 Region: 327-592
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.01e-55
Family Nuclear receptor ligand-binding domain 0.0000000207
Further Details:      
 
Domain Number 2 Region: 255-332
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 5.71e-28
Family Nuclear receptor 0.0000143
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000021940   Gene: ENSLAFG00000016922   Transcript: ENSLAFT00000030476
Sequence length 594
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_6:59408144:59441633:-1 gene:ENSLAFG00000016922 transcript:ENSLAFT00000030476 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPCVQAQYSPSPPGSSYAAQTYGSEYTPEIMNPDYTKLTMDFGSTEITATATTSLPSFST
FMEGYSSSYELKPSCLYQMQPSGPRPLIKMEEGRAHEQQQQQPIHPSSSPEDEVLPSTSM
YFKQSPPSTPSTPSFPPQAGAVWDEALPSAPGCIAPGPAAGPADEGGCPRWPGARYPALP
LQNPSPPHPARGPALAGGHMLSRANPYGLALAKRAAALAFPPLGLTASAASSSLLGESPG
LPSPPNRSSSSGEGTCAVCGDNAACQHYGVRTCEGCKGFFKRTVQKNAKYVCLANKNCPV
DKRRRNRCQYCRFQKCLSVGMVKEVVRTDSLKGRRGRLPSKPKSPLQQEPSQPSPPSPPI
CMMNALVRALTDSTPRDLDYSRFRKNYCSTDQAAAGTDAEHVQQFYNLLTASIDVSRSWA
EKIPGFTDLPKEDQTLLIESAFLELFVLRLSIRSNTAEDKFVFCNGLVLHRLQCLRGFGE
WLDSIKDFSLNLQSLNLDIQALACLSALSMVTERHGLQEPKRVEELCNKITSSLKDHQSK
GQALEPTEPKVLRALVELRKICTLGLQRIFYLKLEDLVSPPSIIDKLFLDTLPF
Download sequence
Identical sequences G3U282
ENSLAFP00000021940

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]