SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000021959 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000021959
Domain Number 1 Region: 80-294
Classification Level Classification E-value
Superfamily Integrin domains 8.89e-17
Family Integrin domains 0.0098
Further Details:      
 
Domain Number 2 Region: 4-72
Classification Level Classification E-value
Superfamily Integrin domains 0.0000000000303
Family Integrin domains 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000021959   Gene: ENSLAFG00000026278   Transcript: ENSLAFT00000029964
Sequence length 347
Comment pep:novel supercontig:loxAfr3:scaffold_36:2340731:2424802:-1 gene:ENSLAFG00000026278 transcript:ENSLAFT00000029964 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QEEMGISCELLEPDFLKCSVGFPFMRSKSKYEFSVIFDTSHLSGEEDVLTFIVTAQSGNV
ERSESLHDNALSLTVPLMHEVDTSITGLMSPTSFVYGESVDTSSFVQLDDLECRFQRLNV
TLQVYNAGPSTLPGSSVSISFPSRLSSGGAEMLHIQEMMVGQEKGNCSFQKNPTPCIIPQ
EQENIFHTIFAFFTKSGRKVLDCEKPGISCLTVHCNLSTLAKEESRTIDVYMLLNTEILK
RDSSSVIQFMTRAKVKVDPALRVVEIADGNPEEMTVVFEALHNLEPRGYVVGWIIAISLL
VGILIFLLLAVLLWKMGFFRRRYKEIIEAEKNRKENEDSWDWVQKSQ
Download sequence
Identical sequences G3U2A1
ENSLAFP00000021959 ENSLAFP00000021959

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]