SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000022065 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000022065
Domain Number 1 Region: 638-805
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.16e-51
Family BCR-homology GTPase activation domain (BH-domain) 0.0000482
Further Details:      
 
Domain Number 2 Region: 79-280
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 9.42e-46
Family DBL homology domain (DH-domain) 0.00053
Further Details:      
 
Domain Number 3 Region: 294-363,421-456
Classification Level Classification E-value
Superfamily PH domain-like 8.63e-17
Family Pleckstrin-homology domain (PH domain) 0.017
Further Details:      
 
Domain Number 4 Region: 498-624
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.0000000000000483
Family Synaptotagmin-like (S variant) 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000022065   Gene: ENSLAFG00000015367   Transcript: ENSLAFT00000036927
Sequence length 859
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_68:1558028:1624944:-1 gene:ENSLAFG00000015367 transcript:ENSLAFT00000036927 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QEPLGRRLIVRLFFYATFGTPPGYGCAADRDEEQRRHQDGLPYIDDSPSSSPNLSSKGRG
GRDALAAGTSESTKGGELDLEKGLEMRKWVLSGILASEETYLSHLEALLLPMKPLKAAAT
TSQPVLTIQQIETIFFKVPELYEIHKDFYDGLLPRVQQWGHQQRVGDLFQKLASQLGVYR
AFVDNYGVAMETAEKCCQANAQFAEISENLRARSNKDSKDQTTKNSLETLLYKPVDRVTR
STLVLHDLLKHTPPSHPDHPLLQDALRISQNFLSSINEEITPRRQSMTVKKGEHRQLLKD
SFMVELVEGARKLRHVFLFTDLLLCAKLKKQSGSKTQHYDCKWYIPLTDLSFQTVDETEA
APNLPLVPDEELDAMKIKISQIKNEIQREKRANKGSKAIERLKKKLSEQESLLLLMSPNM
AFRVHNRNGKSYTFLISSDYERAEWRENIREQQKKCFKSFSLTSVELQMLTNSCVKLQTV
HNIPLTINKEDDESPGLYGFLNVIVHSATGFKQSSNLYCTLEVDSFGYFVNKAKTRVYRD
TAEPNWNEEFEIELEGSQTLRILCYEKCYNKTKVTKEDGENTDRIMGKGQVQLDPQALQD
KDWQRTVITMNGIEVKLSVKFTSREFSLKRMPSRKQTGVFGVKIAVVTKRERSKVPYIVR
QCVEEIERRGMEEVGIYRVSGVATDIQALKAAFDANNKDVSVMMSEMDVNAIAGTLKLYF
RELPEPLFTDEFYPNFAEGIALSDPVAKESCMLNLLLSLPEANLVTFLFLLDHLKRVAEK
ETVNKMSLHNLATVFGPTLLRPSEKESKLPATPGQPITMTDSWSLEVMSQVQVLLYFLQL
EAIPAPDSKRQSVLFSTEV
Download sequence
Identical sequences G3U2K7
ENSLAFP00000022065

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]