SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000022093 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000022093
Domain Number 1 Region: 37-93
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000000000912
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.003
Further Details:      
 
Domain Number 2 Region: 195-278
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000889
Family Ras-binding domain, RBD 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000022093   Gene: ENSLAFG00000010924   Transcript: ENSLAFT00000036214
Sequence length 331
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_12:17201861:17210636:1 gene:ENSLAFG00000010924 transcript:ENSLAFT00000036214 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAEPELIELRDLAPALERANALRIAPGTTRNPARQLAPGRGHRFQPAGPTTHTWCDLCG
DFIWGVVRKGLQCAHCKFTCHYRCRALVCLDCCGPRDLGWEPALERDTNVDEPVEWETPD
LSQAEIEQKIKEYNSQINSNLFMSLNKDGSYTGFIKVQLKLVRPVSVPASKKPPSLQDAR
RSPVRGTAVRRRTSFYLPKDAVKHLHVLSRTRAREVIEALLRKFLVVDDPRKFALFERAE
RHGQVYLRKLSDDEQPLRLRLLAGPSEKALSFVLKENDSGEVNWDAFSMPELHNFLRILQ
REEEEHLRQILQKYSCCRQKIQEALHACPLG
Download sequence
Identical sequences G3U2N5
ENSLAFP00000022093

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]